[Salaries in UAE](https://jobicy.com/salaries/ae.md)2026 Salary Report

# Financial Planning Analyst salary in UAE.

The average salary for Financial Planning Analyst in UAE is $73,200 per year, according to Jobicy salary data updated 10 Oct 2026. Entry-level positions start around $45,000–$58,700, while experienced professionals earn $89,900–$137,900.
Average compensation has increased 10.4% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 10 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$73,200Estimated annual average$6,100Estimated monthly take-home$22.88–$54.55Hourly equivalent range10 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The core purpose of a Financial Planning Analyst is practical: the professional builds budgets, forecasts, scenarios, and performance narratives that guide resource allocation. Day-to-day priorities vary by company, but performance is generally visible in forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For UAE, this report combines salary benchmarks in AED with modeled assumptions for a 0% tax rate, 30 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

High accuracy755 recent job listings and community reports shaped this estimateUpdated 10 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$73,200Annual benchmarkJunior$45,000–$58,7000-2 yearsMid-level$58,200–$91,2003-5 yearsSenior$89,900–$137,9006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 0% tax rate$6,100Hourly equivalentBased on a standard 40-hour week$22.88–$54.55Potential annual bonusIllustrative 10–15% performance range$7,320–$10,980

### Planning reference

Monthly savings target32% illustrative allocation$2,000Retirement contribution12% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,200Emergency fundThree to six months of gross income$18,300–$36,600

### Healthcare infrastructure

Private-market healthcare estimateIllustrative annual allowance for medical, dental, and vision insurance in a private-tier employment or contractor market≈ $4,392/year
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Financial Planning Analyst pay in UAE.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Financial Planning Analyst in UAE](https://jobicy.com/api/jpgraph/chart.php?junior_min=45000&junior_max=58700&middle_min=58200&middle_max=91200&senior_min=89900&senior_max=137900&average=73200&currency=%24&currency_code=USD&title=Financial%20Planning%20Analyst&country=UAE)
Salary ranges

Enlarge
![Salary progression by experience for Financial Planning Analyst in UAE](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=51850&m_avg=74700&s_avg=113900&currency=%24&currency_code=USD&title=Financial%20Planning%20Analyst&country=UAE)
Experience growthEnlarge
![Illustrative monthly salary allocation for Financial Planning Analyst in UAE](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=0&savings=1952&retirement=708&housing=1220&disposable=2220&currency=%24&currency_code=USD&title=Financial%20Planning%20Analyst&country=UAE)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 10.4% over the displayed period, moving from $66,300 to $73,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$73,200$23–$55Sep 2026$69,900$22–$52Aug 2026$70,500$22–$53Jul 2026$72,700$23–$54Jun 2026$68,800$22–$51May 2026$71,300$22–$53Apr 2026$72,200$23–$54Mar 2026$69,000$22–$51Feb 2026$68,600$21–$51Jan 2026$66,500$21–$50Dec 2025$69,500$22–$52Nov 2025$66,300$21–$49Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Serve Robotics logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/8ad805d9-221.png) Financial Analyst, FP&AServe Robotics→](https://jobicy.com/jobs/155309-financial-analyst-fpa-3.md) [![UpGuard logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/474a12c7-221.png) Lead Product ManagerUpGuard→](https://jobicy.com/jobs/155239-lead-product-manager-3.md) [![Algolia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201202014849-982609.jpg) Account Manager - Dutch speakingAlgolia→](https://jobicy.com/jobs/155208-account-manager-dutch-speaking.md) [![hims & hers logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2023/11/e7b9b920-221.jpeg) Senior Financial Analyst, Strategic Finance - FP&Ahims & hers→](https://jobicy.com/jobs/153038-senior-financial-analyst-strategic-finance-fpa.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Planning%20Analyst.md)Career profile

## Pay drivers and skills for Financial Planning Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliation

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Automation and systems labsFinancial modeling practiceControl and compliance refreshersScenario-planning workshopsData visualization training

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliationControlsReportingBusiness partnering

### Trending and emerging skills

Integrated business planningContinuous planningFinance automationScenario modelingReal-time reportingAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Financial Planning Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Financial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposureInfluence on capital and operating decisions

### Typical career path

Entry-level or associate role in the disciplineFinancial Planning AnalystSenior Financial Planning AnalystSenior analyst, finance manager, controllership, treasury, or finance leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseExcelGoogle SheetsERP systemsPower BISQLPlanning softwareReconciliation tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Financial Analyst →](https://jobicy.com/salaries/ae/financial-analyst.md)[Financial Data Analyst →](https://jobicy.com/salaries/ae/financial-data-analyst.md)[Financial Reporting Manager →](https://jobicy.com/salaries/ae/financial-reporting-manager.md)[Financial Systems Manager →](https://jobicy.com/salaries/ae/financial-systems-manager.md)[Fintech Product Manager →](https://jobicy.com/salaries/ae/fintech-product-manager.md)[Investment Operations Manager →](https://jobicy.com/salaries/ae/investment-operations-manager.md)[Payment Systems Analyst →](https://jobicy.com/salaries/ae/payment-systems-analyst.md)[Token Economist →](https://jobicy.com/salaries/ae/token-economist.md)Market intelligence

## Hiring context for Financial Planning Analyst in UAE.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Implementation of flexible scheduling options including compressed workweeks and core collaboration hours

###

Key industries

Financial ServicesFinTechBankingInvestment ManagementSoftware as a ServiceE-commerceCross-country pay scale

## Compare Financial Planning Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$51,40030% lower](https://jobicy.com/salaries/at/financial-planning-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$88,50021% higher](https://jobicy.com/salaries/au/financial-planning-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$63,10014% lower](https://jobicy.com/salaries/be/financial-planning-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$84,60016% higher](https://jobicy.com/salaries/ca/financial-planning-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$113,60055% higher](https://jobicy.com/salaries/ch/financial-planning-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$72,4001% lower](https://jobicy.com/salaries/de/financial-planning-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$41,30044% lower](https://jobicy.com/salaries/es/financial-planning-analyst.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$56,10023% lower](https://jobicy.com/salaries/fr/financial-planning-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Financial Planning Analyst salary in UAE?

The estimated average annual salary is $73,200. Junior roles are estimated at $45,000–$58,700, while senior roles are estimated at $89,900–$137,900.

What is the hourly rate for this role?

The estimated hourly equivalent is between $22.88 and $54.55 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Financial modeling, Forecasting, Variance analysis, Management reporting, Financial analysis. Trending and emerging requirements include Integrated business planning, Continuous planning, Finance automation, Scenario modeling, Real-time reporting.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Financial Planning Analyst in UAE, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for UAE and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Financial Planning Analyst in UAE, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Planning%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)