[Salaries in Austria](https://jobicy.com/salaries/at.md)2026 Salary Report

# Data Privacy Officer salary in Austria.

A Data Privacy Officer turns privacy obligations into practical data controls, assessments, records, and response processes. The work combines subject-matter judgment with disciplined execution and is commonly assessed through control effectiveness, remediation quality, audit readiness, regulatory timeliness, risk reduction, and decision clarity. For Austria, this report combines salary benchmarks in EUR with modeled assumptions for a 42% tax rate, 25 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$67,300Estimated annual average$3,253Estimated monthly take-home$21.03–$50.15Hourly equivalent range2 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy681 recent job listings and community reports shaped this estimateUpdated 2 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$67,300Annual benchmarkJunior$40,400–$55,0000-2 yearsMid-level$53,800–$80,0003-5 yearsSenior$78,500–$125,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 42% tax rate$3,253Hourly equivalentBased on a standard 40-hour week$21.03–$50.15Potential annual bonusIllustrative 10–15% performance range$6,730–$10,095

### Planning reference

Monthly savings target33% illustrative allocation$1,900Retirement contribution16% illustrative allocation$900Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$16,825–$33,650

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 42% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Data Privacy Officer pay in Austria.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Data Privacy Officer in Austria](https://jobicy.com/api/jpgraph/chart.php?junior_min=40400&junior_max=55000&middle_min=53800&middle_max=80000&senior_min=78500&senior_max=125600&average=67300&currency=%24&currency_code=USD&title=Data%20Privacy%20Officer&country=Austria)
Salary ranges

Enlarge
![Salary progression by experience for Data Privacy Officer in Austria](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=47700&m_avg=66900&s_avg=102050&currency=%24&currency_code=USD&title=Data%20Privacy%20Officer&country=Austria)
Experience growthEnlarge
![Illustrative monthly salary allocation for Data Privacy Officer in Austria](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2356&savings=1868&retirement=903&housing=1122&disposable=0&currency=%24&currency_code=USD&title=Data%20Privacy%20Officer&country=Austria)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 0.3% over the displayed period, moving from $67,500 to $67,300.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$67,300$21–$50Sep 2026$66,700$21–$50Aug 2026$70,500$22–$53Jul 2026$68,700$21–$51Jun 2026$70,100$22–$52May 2026$69,100$22–$51Apr 2026$67,200$21–$50Mar 2026$68,900$22–$51Feb 2026$67,300$21–$50Jan 2026$65,100$20–$49Dec 2025$67,900$21–$51Nov 2025$67,500$21–$50Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![1Password logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/09/WRILS-200909195848-296323.png) Country Manager, Australia & New Zealand1Password→](https://jobicy.com/jobs/155027-country-manager-australia-new-zealand.md) [![Quantum Metric logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/52363ead-221.jpg) Strategic Account Executive, BFSIQuantum Metric→](https://jobicy.com/jobs/152788-strategic-account-executive-bfsi.md) [![Veeam Software logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/f7716b71-221.jpg) Sr. Customer Success EngineerVeeam Software→](https://jobicy.com/jobs/150280-sr-customer-success-engineer.md) [![Abby Care logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/3d3ea8fe-221.jpeg) Associate General Counsel, Privacy, Product & AIAbby Care→](https://jobicy.com/jobs/154689-associate-general-counsel-privacy-product-ai.md) [![Fastly logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/10/127f9e4bbbdb8767bef358a23bf7f73d.jpeg) Senior Enterprise Account ExecutiveFastly→](https://jobicy.com/jobs/152564-senior-enterprise-account-executive-2.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Privacy%20Officer.md)Career profile

## Pay drivers and skills for Data Privacy Officer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Privacy impact assessmentsData mappingPrivacy by designRegulatory interpretationRegulatory analysisPolicy design

### Education requirements

A degree in law, public policy, information governance, risk, technology, or equivalent regulatory experienceDemonstrated ability to interpret obligations and translate them into proportionate, testable operational controls

### Training and development

Control-design workshopsAudit and evidence simulationsIncident and breach exercisesExecutive risk communication practiceRegulatory update briefings

### Professional certifications

Relevant privacy, compliance, audit, or risk certification when applicable

### Core skills

Privacy impact assessmentsData mappingPrivacy by designRegulatory interpretationRegulatory analysisPolicy designRisk assessmentControl designAudit evidence

### Trending and emerging skills

AI governancePrivacy engineeringAutomated control testingThird-party risk managementContinuous complianceMachine-readable regulationAlgorithmic accountabilityPrivacy-enhancing technologiesDigital identity assurance

### Key responsibilities

Own the planning and delivery of work in the Data Privacy Officer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against control effectiveness, remediation quality, audit readiness, regulatory timeliness, risk reduction, and decision clarityCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsRegulatory complexity and jurisdiction coverageControl and audit ownershipProfessional privacy, risk, or compliance credentialsMateriality of governed systems and dataExecutive and regulator interaction

### Typical career path

Senior individual contributor or team leadData Privacy OfficerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Independent governance function working through documented assessments, evidence, review forums, and confidential issue managementAdvises legal, security, data, product, engineering, finance, operations, and executive stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeGovernance platformsRisk registersPolicy repositoriesAudit workflow tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/at/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/at/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/at/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/at/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/at/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/at/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/at/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/at/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/at/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/at/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/at/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/at/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/at/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/at/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/at/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/at/customer-success-director.md)Market intelligence

## Hiring context for Data Privacy Officer in Austria.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Focus on digital well-being and work-life balance initiatives specific to remote work environments

###

Key industries

Privacy TechnologyFinancial ServicesHealthcare TechnologySoftware as a ServiceCross-country pay scale

## Compare Data Privacy Officer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$88,80032% higher](https://jobicy.com/salaries/ae/data-privacy-officer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$116,20073% higher](https://jobicy.com/salaries/au/data-privacy-officer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$77,70015% higher](https://jobicy.com/salaries/be/data-privacy-officer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$116,20073% higher](https://jobicy.com/salaries/ca/data-privacy-officer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$150,100123% higher](https://jobicy.com/salaries/ch/data-privacy-officer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$94,90041% higher](https://jobicy.com/salaries/de/data-privacy-officer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$55,20018% lower](https://jobicy.com/salaries/es/data-privacy-officer.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$73,4009% higher](https://jobicy.com/salaries/fr/data-privacy-officer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Data Privacy Officer salary in Austria?

The estimated average annual salary is $67,300. Junior roles are estimated at $40,400–$55,000, while senior roles are estimated at $78,500–$125,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $21.03 and $50.15 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Privacy impact assessments, Data mapping, Privacy by design, Regulatory interpretation, Regulatory analysis. Trending and emerging requirements include AI governance, Privacy engineering, Automated control testing, Third-party risk management, Continuous compliance.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Data Privacy Officer in Austria, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Austria and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Data Privacy Officer in Austria, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Privacy%20Officer.md)[Salary API](https://jobicy.com/salary-api.md)