[Salaries in Austria](https://jobicy.com/salaries/at.md)2026 Salary Report

# Financial Data Analyst salary in Austria.

In a remote organization, a Financial Data Analyst turns finance data into controlled models and explanations for performance, risk, and planning decisions. The position rewards independent ownership, documented reasoning, and continuous improvement across forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For Austria, this report combines salary benchmarks in EUR with modeled assumptions for a 42% tax rate, 25 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$49,900Estimated annual average$2,412Estimated monthly take-home$15.59–$37.19Hourly equivalent range2 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy446 recent job listings and community reports shaped this estimateUpdated 2 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$49,900Annual benchmarkJunior$30,500–$41,6000-2 yearsMid-level$39,600–$60,8003-5 yearsSenior$58,500–$90,2006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 42% tax rate$2,412Hourly equivalentBased on a standard 40-hour week$15.59–$37.19Potential annual bonusIllustrative 10–15% performance range$4,990–$7,485

### Planning reference

Monthly savings target24% illustrative allocation$1,000Retirement contribution16% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $800Emergency fundThree to six months of gross income$12,475–$24,950

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 42% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Financial Data Analyst pay in Austria.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Financial Data Analyst in Austria](https://jobicy.com/api/jpgraph/chart.php?junior_min=30500&junior_max=41600&middle_min=39600&middle_max=60800&senior_min=58500&senior_max=90200&average=49900&currency=%24&currency_code=USD&title=Financial%20Data%20Analyst&country=Austria)
Salary ranges

Enlarge
![Salary progression by experience for Financial Data Analyst in Austria](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=36050&m_avg=50200&s_avg=74350&currency=%24&currency_code=USD&title=Financial%20Data%20Analyst&country=Austria)
Experience growthEnlarge
![Illustrative monthly salary allocation for Financial Data Analyst in Austria](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1747&savings=990&retirement=653&housing=832&disposable=0&currency=%24&currency_code=USD&title=Financial%20Data%20Analyst&country=Austria)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.2% over the displayed period, moving from $49,300 to $49,900.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$49,900$16–$37Sep 2026$50,800$16–$38Aug 2026$51,500$16–$38Jul 2026$49,900$16–$37Jun 2026$51,100$16–$38May 2026$48,900$15–$36Apr 2026$48,700$15–$36Mar 2026$49,400$15–$37Feb 2026$50,300$16–$37Jan 2026$47,600$15–$35Dec 2025$49,600$16–$37Nov 2025$49,300$15–$37Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Monks logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/d832a699-221.jpeg) Performance Media AnalystMonks→](https://jobicy.com/jobs/152913-performance-media-analyst.md) [![Kalshi logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/00635b6c-221.png) Operations Risk AnalystKalshi→](https://jobicy.com/jobs/152900-operations-risk-analyst.md) [![Jobber logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/135a74b7-221.jpeg) Manager, Credit RiskJobber→](https://jobicy.com/jobs/154930-manager-credit-risk.md) [![hims & hers logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2023/11/e7b9b920-221.jpeg) Financial Analyst, FP&Ahims & hers→](https://jobicy.com/jobs/154913-financial-analyst-fpa-2.md) [![Samsara logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/dd26f5ca-221.jpg) Deal Desk AnalystSamsara→](https://jobicy.com/jobs/154902-deal-desk-analyst-6.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Data%20Analyst.md)Career profile

## Pay drivers and skills for Financial Data Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliation

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Financial modeling practiceControl and compliance refreshersScenario-planning workshopsData visualization trainingAutomation and systems labs

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliationControlsReportingBusiness partnering

### Trending and emerging skills

Real-time reportingIntegrated business planningContinuous planningFinance automationScenario modelingAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Financial Data Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsFinancial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposure

### Typical career path

Entry-level or associate role in the disciplineFinancial Data AnalystSenior Financial Data AnalystSenior analyst, finance manager, controllership, treasury, or finance leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeExcelGoogle SheetsERP systemsPower BI

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/at/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/at/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/at/analytics-implementation-manager.md)[Blockchain Analyst →](https://jobicy.com/salaries/at/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/at/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/at/business-intelligence-analyst.md)[Customer Experience Analyst →](https://jobicy.com/salaries/at/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/at/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/at/customer-intelligence-analyst.md)[Data Engineer →](https://jobicy.com/salaries/at/data-engineer.md)[Data Entry Specialist →](https://jobicy.com/salaries/at/data-entry-specialist.md)[Data Governance Manager →](https://jobicy.com/salaries/at/data-governance-manager.md)[Data Governance Specialist →](https://jobicy.com/salaries/at/data-governance-specialist.md)[Data Migration Specialist →](https://jobicy.com/salaries/at/data-migration-specialist.md)[Data Privacy Consultant →](https://jobicy.com/salaries/at/data-privacy-consultant.md)[Data Quality Analyst →](https://jobicy.com/salaries/at/data-quality-analyst.md)Market intelligence

## Hiring context for Financial Data Analyst in Austria.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Investment in high-quality home office equipment and ergonomic workspace solutions for remote employees

###

Key industries

Financial ServicesFinTechBankingInvestment ManagementSoftware as a ServiceE-commerceCross-country pay scale

## Compare Financial Data Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$68,20037% higher](https://jobicy.com/salaries/ae/financial-data-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$86,30073% higher](https://jobicy.com/salaries/au/financial-data-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$57,10014% higher](https://jobicy.com/salaries/be/financial-data-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$84,50069% higher](https://jobicy.com/salaries/ca/financial-data-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$112,400125% higher](https://jobicy.com/salaries/ch/financial-data-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$69,90040% higher](https://jobicy.com/salaries/de/financial-data-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$39,30021% lower](https://jobicy.com/salaries/es/financial-data-analyst.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$52,3005% higher](https://jobicy.com/salaries/fr/financial-data-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Financial Data Analyst salary in Austria?

The estimated average annual salary is $49,900. Junior roles are estimated at $30,500–$41,600, while senior roles are estimated at $58,500–$90,200.

What is the hourly rate for this role?

The estimated hourly equivalent is between $15.59 and $37.19 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Financial modeling, Forecasting, Variance analysis, Management reporting, Financial analysis. Trending and emerging requirements include Real-time reporting, Integrated business planning, Continuous planning, Finance automation, Scenario modeling.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Financial Data Analyst in Austria, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Austria and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Financial Data Analyst in Austria, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Data%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)