[Salaries in Austria](https://jobicy.com/salaries/at.md)2026 Salary Report

# Mental Health Counselor salary in Austria.

The Mental Health Counselor role provides ethical, confidential counseling using evidence-based methods, appropriate boundaries, and risk protocols. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include clinical appropriateness, client-reported progress, continuity of care, documentation quality, safety, and ethical compliance. For Austria, this report combines salary benchmarks in EUR with modeled assumptions for a 42% tax rate, 25 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$39,000Estimated annual average$1,885Estimated monthly take-home$12.19–$29.06Hourly equivalent range5 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy461 recent job listings and community reports shaped this estimateUpdated 5 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$39,000Annual benchmarkJunior$24,600–$32,1000-2 yearsMid-level$31,100–$48,0003-5 yearsSenior$45,400–$73,0006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 42% tax rate$1,885Hourly equivalentBased on a standard 40-hour week$12.19–$29.06Potential annual bonusIllustrative 10–15% performance range$3,900–$5,850

### Planning reference

Monthly savings target21% illustrative allocation$700Retirement contribution17% illustrative allocation$500Housing budgetIllustrative 20% monthly ceilingUp to $700Emergency fundThree to six months of gross income$9,750–$19,500

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 42% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Mental Health Counselor pay in Austria.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Mental Health Counselor in Austria](https://jobicy.com/api/jpgraph/chart.php?junior_min=24600&junior_max=32100&middle_min=31100&middle_max=48000&senior_min=45400&senior_max=73000&average=39000&currency=%24&currency_code=USD&title=Mental%20Health%20Counselor&country=Austria)
Salary ranges

Enlarge
![Salary progression by experience for Mental Health Counselor in Austria](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=28350&m_avg=39550&s_avg=59200&currency=%24&currency_code=USD&title=Mental%20Health%20Counselor&country=Austria)
Experience growthEnlarge
![Illustrative monthly salary allocation for Mental Health Counselor in Austria](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1365&savings=676&retirement=543&housing=650&disposable=16&currency=%24&currency_code=USD&title=Mental%20Health%20Counselor&country=Austria)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3.7% over the displayed period, moving from $37,600 to $39,000.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$39,000$12–$29Sep 2026$39,300$12–$29Aug 2026$38,600$12–$29Jul 2026$38,800$12–$29Jun 2026$38,400$12–$29May 2026$37,900$12–$28Apr 2026$38,000$12–$28Mar 2026$37,300$12–$28Feb 2026$38,800$12–$29Jan 2026$39,800$12–$30Dec 2025$38,500$12–$29Nov 2025$37,600$12–$28Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[Explore remote Mental Health Counselor jobsOpen the current Jobicy job search→](https://jobicy.com/jobs?search_keywords=Mental%20Health%20Counselor.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Mental%20Health%20Counselor.md)Career profile

## Pay drivers and skills for Mental Health Counselor.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Clinical assessmentTherapeutic communicationCase formulationEvidence-based counselingRisk assessmentTreatment planning

### Education requirements

A qualifying graduate degree in counseling, psychology, social work, or another locally recognized clinical disciplineCurrent professional license or supervised eligibility appropriate to the jurisdiction and scope of practice

### Training and development

Suicide-risk assessment refreshersTrauma-informed care workshopsTelehealth ethics and privacy trainingCultural humility and accessibility practiceClinical supervision

### Professional certifications

Active counseling or mental-health license required by the applicable jurisdiction

### Core skills

Clinical assessmentTherapeutic communicationCase formulationEvidence-based counselingRisk assessmentTreatment planningClinical documentationProfessional ethics

### Trending and emerging skills

Integrated behavioral healthMeasurement-based careTrauma-informed practiceTelehealth deliveryCulturally responsive careDigital therapeuticsHybrid care pathwaysAI documentation safeguardsRemote group interventions

### Key responsibilities

Own the planning and delivery of work in the Mental Health Counselor remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against clinical appropriateness, client-reported progress, continuity of care, documentation quality, safety, and ethical complianceCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Professional license and jurisdictionSpecialized clinical trainingCaseload complexity and risk responsibilitySupervision or program leadershipLanguage and population expertiseEmployment setting and reimbursement model

### Typical career path

Entry-level or associate role in the disciplineMental Health CounselorSenior Mental Health CounselorSenior clinician, clinical supervisor, program leadership, or specialized independent practice

### Work specifics

Confidential remote or hybrid clinical setting with secure records, defined emergency procedures, supervision, and jurisdiction-aware practiceCoordinates, with consent and within professional boundaries, with clients, supervisors, healthcare providers, and crisis resourcesRequires scheduled live sessions in the client jurisdiction, plus reliable availability for documentation and defined escalation proceduresSecure telehealth platformElectronic health recordsOutcome assessment toolsSecure schedulingClinical reference resourcesEncrypted communication

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Chat Support Lead →](https://jobicy.com/salaries/at/chat-support-lead.md)[Community Success Manager →](https://jobicy.com/salaries/at/community-success-manager.md)[Customer Experience Analyst →](https://jobicy.com/salaries/at/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/at/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/at/customer-intelligence-analyst.md)[Customer Success Director →](https://jobicy.com/salaries/at/customer-success-director.md)[Customer Success Manager →](https://jobicy.com/salaries/at/customer-success-manager.md)[Customer Support Specialist →](https://jobicy.com/salaries/at/customer-support-specialist.md)[Gaming Community Manager →](https://jobicy.com/salaries/at/gaming-community-manager.md)[Implementation Consultant →](https://jobicy.com/salaries/at/implementation-consultant.md)[Partner Success Manager →](https://jobicy.com/salaries/at/partner-success-manager.md)[Platform Support Specialist →](https://jobicy.com/salaries/at/platform-support-specialist.md)[Support Knowledge Manager →](https://jobicy.com/salaries/at/support-knowledge-manager.md)[Support Quality Analyst →](https://jobicy.com/salaries/at/support-quality-analyst.md)[Technical Support Engineer →](https://jobicy.com/salaries/at/technical-support-engineer.md)[Technical Support Manager →](https://jobicy.com/salaries/at/technical-support-manager.md)Market intelligence

## Hiring context for Mental Health Counselor in Austria.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Expanding global remote workforce supported by investment in virtual team building and online social engagement

###

Key industries

Behavioral HealthTelehealthHealthcareEmployee Assistance ProgramsCross-country pay scale

## Compare Mental Health Counselor pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$51,40032% higher](https://jobicy.com/salaries/ae/mental-health-counselor.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$65,60068% higher](https://jobicy.com/salaries/au/mental-health-counselor.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$47,70022% higher](https://jobicy.com/salaries/be/mental-health-counselor.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$64,60066% higher](https://jobicy.com/salaries/ca/mental-health-counselor.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$85,400119% higher](https://jobicy.com/salaries/ch/mental-health-counselor.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$54,70040% higher](https://jobicy.com/salaries/de/mental-health-counselor.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$33,40014% lower](https://jobicy.com/salaries/es/mental-health-counselor.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$40,3003% higher](https://jobicy.com/salaries/fr/mental-health-counselor.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Mental Health Counselor salary in Austria?

The estimated average annual salary is $39,000. Junior roles are estimated at $24,600–$32,100, while senior roles are estimated at $45,400–$73,000.

What is the hourly rate for this role?

The estimated hourly equivalent is between $12.19 and $29.06 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Clinical assessment, Therapeutic communication, Case formulation, Evidence-based counseling, Risk assessment. Trending and emerging requirements include Integrated behavioral health, Measurement-based care, Trauma-informed practice, Telehealth delivery, Culturally responsive care.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Mental Health Counselor in Austria, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Austria and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Mental Health Counselor in Austria, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Mental%20Health%20Counselor.md)[Salary API](https://jobicy.com/salary-api.md)