[Salaries in Australia](https://jobicy.com/salaries/au.md)2026 Salary Report

# Fintech Product Manager salary in Australia.

The core purpose of a Fintech Product Manager is practical: the professional develops financial products that balance customer value, regulation, risk, economics, and reliable delivery. Day-to-day priorities vary by company, but performance is generally visible in forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For Australia, this report combines salary benchmarks in AUD with modeled assumptions for a 32% tax rate, 20 days of annual leave, and a 85.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$118,400Estimated annual average$6,709Estimated monthly take-home$37.00–$88.23Hourly equivalent range29 Sep 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1510 recent job listings and community reports shaped this estimateUpdated 29 Sep 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$118,400Annual benchmarkJunior$69,100–$91,4000-2 yearsMid-level$96,700–$142,4003-5 yearsSenior$145,200–$214,9006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 32% tax rate$6,709Hourly equivalentBased on a standard 40-hour week$37.00–$88.23Potential annual bonusIllustrative 10–15% performance range$11,840–$17,760

### Planning reference

Monthly savings target33% illustrative allocation$3,200Retirement contribution11% illustrative allocation$1,100Housing budgetIllustrative 20% monthly ceilingUp to $2,000Emergency fundThree to six months of gross income$29,600–$59,200

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 32% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Fintech Product Manager pay in Australia.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Fintech Product Manager in Australia](https://jobicy.com/api/jpgraph/chart.php?junior_min=69100&junior_max=91400&middle_min=96700&middle_max=142400&senior_min=145200&senior_max=214900&average=118400&currency=%24&currency_code=USD&title=Fintech%20Product%20Manager&country=Australia)
Salary ranges

Enlarge
![Salary progression by experience for Fintech Product Manager in Australia](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=80250&m_avg=119550&s_avg=180050&currency=%24&currency_code=USD&title=Fintech%20Product%20Manager&country=Australia)
Experience growthEnlarge
![Illustrative monthly salary allocation for Fintech Product Manager in Australia](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=3157&savings=3207&retirement=1095&housing=1973&disposable=434&currency=%24&currency_code=USD&title=Fintech%20Product%20Manager&country=Australia)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 6.2% over the displayed period, moving from $111,500 to $118,400.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$118,400$37–$88Sep 2026$119,400$37–$89Aug 2026$117,600$37–$88Jul 2026$116,400$36–$87Jun 2026$112,600$35–$84May 2026$112,400$35–$84Apr 2026$112,500$35–$84Mar 2026$112,300$35–$84Feb 2026$110,600$35–$82Jan 2026$116,200$36–$87Dec 2025$115,100$36–$86Nov 2025$111,500$35–$83Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![CertiK logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210308091023-955845.jpg) Business Development Manager - SingaporeCertiK→](https://jobicy.com/jobs/152987-business-development-manager-singapore.md) [![Juniper Square logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/90c359a8bed816e81ea39fa33a8314f3.png) Account Executive, Private Equity Real EstateJuniper Square→](https://jobicy.com/jobs/154949-account-executive-private-equity-real-estate.md) [![Jobber logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/135a74b7-221.jpeg) Manager, Credit RiskJobber→](https://jobicy.com/jobs/154930-manager-credit-risk.md) [![Paddle logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/28ca3645-221.png) Staff Product ManagerPaddle→](https://jobicy.com/jobs/154921-staff-product-manager-3.md) [![Givebutter logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/05/51ca261310065df6b11ed6c81972be72.jpg) Engineering Manager, TreasuryGivebutter→](https://jobicy.com/jobs/154919-engineering-manager-treasury.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Fintech%20Product%20Manager.md)Career profile

## Pay drivers and skills for Fintech Product Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Product discoveryRoadmappingOutcome metricsPrioritizationFinancial analysisForecasting

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Control and compliance refreshersScenario-planning workshopsData visualization trainingAutomation and systems labsFinancial modeling practice

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Product discoveryRoadmappingOutcome metricsPrioritizationFinancial analysisForecastingReconciliationFinancial modelingControls

### Trending and emerging skills

Continuous planningFinance automationScenario modelingReal-time reportingIntegrated business planningAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Fintech Product Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipFinancial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposure

### Typical career path

Senior individual contributor or team leadFintech Product ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseProductboardAmplitudeFigmaExcelGoogle SheetsERP systemsPower BISQL

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/au/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/au/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/au/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/au/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/au/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/au/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/au/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/au/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/au/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/au/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/au/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/au/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/au/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/au/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/au/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/au/customer-success-director.md)Market intelligence

## Hiring context for Fintech Product Manager in Australia.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Very High

Current hiring-demand signal for this role across the tracked market.

Growth

### 25% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Very High

Integration of virtual reality and augmented reality tools for remote collaboration and training

###

Key industries

FinTechBankingPaymentsFinancial ServicesCross-country pay scale

## Compare Fintech Product Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$92,10022% lower](https://jobicy.com/salaries/ae/fintech-product-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$71,40040% lower](https://jobicy.com/salaries/at/fintech-product-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$77,50035% lower](https://jobicy.com/salaries/be/fintech-product-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$109,0008% lower](https://jobicy.com/salaries/ca/fintech-product-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$147,70025% higher](https://jobicy.com/salaries/ch/fintech-product-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$96,60018% lower](https://jobicy.com/salaries/de/fintech-product-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$53,90054% lower](https://jobicy.com/salaries/es/fintech-product-manager.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$74,30037% lower](https://jobicy.com/salaries/fr/fintech-product-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Fintech Product Manager salary in Australia?

The estimated average annual salary is $118,400. Junior roles are estimated at $69,100–$91,400, while senior roles are estimated at $145,200–$214,900.

What is the hourly rate for this role?

The estimated hourly equivalent is between $37.00 and $88.23 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Product discovery, Roadmapping, Outcome metrics, Prioritization, Financial analysis. Trending and emerging requirements include Continuous planning, Finance automation, Scenario modeling, Real-time reporting, Integrated business planning.

What is the market outlook?

Jobicy currently classifies demand as Very High, with a growth signal of 25% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Fintech Product Manager in Australia, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Australia and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Fintech Product Manager in Australia, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Fintech%20Product%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)