[Salaries in Australia](https://jobicy.com/salaries/au.md)2026 Salary Report

# Support Quality Analyst salary in Australia.

The average salary for Support Quality Analyst in Australia is $66,700 per year, according to Jobicy salary data updated 3 Oct 2026. Entry-level positions start around $38,700–$52,200, while experienced professionals earn $83,100–$123,400.
Average compensation has increased 6% over the past 12 months.
Demand is very high, with a 25% annual growth rate.

Data: Jobicy salary estimates · Updated 3 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$66,700Estimated annual average$3,780Estimated monthly take-home$20.84–$49.70Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

A Support Quality Analyst evaluates service interactions, calibrates standards, identifies coaching needs, and improves support processes. The work combines subject-matter judgment with disciplined execution and is commonly assessed through resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuse. For Australia, this report combines salary benchmarks in AUD with modeled assumptions for a 32% tax rate, 20 days of annual leave, and a 85.0 cost-of-living index relative to the United States baseline.

High accuracy1242 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$66,700Annual benchmarkJunior$38,700–$52,2000-2 yearsMid-level$53,800–$80,5003-5 yearsSenior$83,100–$123,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 32% tax rate$3,780Hourly equivalentBased on a standard 40-hour week$20.84–$49.70Potential annual bonusIllustrative 10–15% performance range$6,670–$10,005

### Planning reference

Monthly savings target28% illustrative allocation$1,600Retirement contribution14% illustrative allocation$800Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$16,675–$33,350

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 32% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Support Quality Analyst pay in Australia.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Support Quality Analyst in Australia](https://jobicy.com/api/jpgraph/chart.php?junior_min=38700&junior_max=52200&middle_min=53800&middle_max=80500&senior_min=83100&senior_max=123400&average=66700&currency=%24&currency_code=USD&title=Support%20Quality%20Analyst&country=Australia)
Salary ranges

Enlarge
![Salary progression by experience for Support Quality Analyst in Australia](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=45450&m_avg=67150&s_avg=103250&currency=%24&currency_code=USD&title=Support%20Quality%20Analyst&country=Australia)
Experience growthEnlarge
![Illustrative monthly salary allocation for Support Quality Analyst in Australia](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1779&savings=1573&retirement=756&housing=1112&disposable=339&currency=%24&currency_code=USD&title=Support%20Quality%20Analyst&country=Australia)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 6% over the displayed period, moving from $62,900 to $66,700.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$66,700$21–$50Sep 2026$64,100$20–$48Aug 2026$66,700$21–$50Jul 2026$67,600$21–$50Jun 2026$66,400$21–$49May 2026$63,500$20–$47Apr 2026$67,800$21–$51Mar 2026$64,000$20–$48Feb 2026$65,000$20–$48Jan 2026$63,200$20–$47Dec 2025$66,100$21–$49Nov 2025$62,900$20–$47Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Spotify logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210328105941-289246.jpg) Research Scientist - Generative AudioSpotify→](https://jobicy.com/jobs/155214-research-scientist-generative-audio.md) [![Instructure logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/430057884baf037dd2aa1e1e017e72b6.jpg) Senior Decision ScientistInstructure→](https://jobicy.com/jobs/155187-senior-decision-scientist-2.md) [![ClickUp logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/cd5be0ef-221.jpg) CX Operations AnalystClickUp→](https://jobicy.com/jobs/155181-cx-operations-analyst.md) [![1Password logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/09/WRILS-200909195848-296323.png) Senior GTM Engineering Analyst1Password→](https://jobicy.com/jobs/153118-senior-gtm-engineering-analyst.md) [![Zapier logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210317121153-967239.png) Manager, GTM AnalyticsZapier→](https://jobicy.com/jobs/153099-manager-gtm-analytics.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Support%20Quality%20Analyst.md)Career profile

## Pay drivers and skills for Support Quality Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Technical troubleshootingCase ownershipEscalation managementKnowledge writingCustomer communicationTroubleshooting

### Education requirements

Relevant higher education or equivalent customer-facing and domain-specific experienceEvidence of clear written communication, structured troubleshooting, sound judgment, and empathetic service

### Training and development

Knowledge-base writing workshopsProduct troubleshooting labsDe-escalation practiceQuality calibration sessionsAccessibility and inclusive service training

### Core skills

Technical troubleshootingCase ownershipEscalation managementKnowledge writingCustomer communicationTroubleshootingCase managementDe-escalationKnowledge management

### Trending and emerging skills

Support operations analyticsOmnichannel supportAI-assisted serviceCustomer health scoringSelf-service designAgent-assist systemsPredictive case routingMultilingual automationProactive support

### Key responsibilities

Own the planning and delivery of work in the Support Quality Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuseInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Product and troubleshooting complexityCustomer segment and service-level responsibilityEscalation and incident ownershipMultilingual or specialized domain capabilityQuality and knowledge-management impactTeam leadership and coverage scope

### Typical career path

Entry-level or associate role in the disciplineSupport Quality AnalystSenior Support Quality AnalystSenior specialist, support lead, customer success, or support operations management

### Work specifics

Remote customer team using documented escalation paths, shared knowledge, quality reviews, and service-level targetsWorks with customers, product, engineering, operations, sales, and success teams to resolve issues and prevent recurrenceFollows documented service coverage and escalation schedules, with live overlap during assigned customer-support hoursZendeskIntercomJira Service ManagementSlackNotionCRM platformsScreen sharingQuality dashboards

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Chat Support Lead →](https://jobicy.com/salaries/au/chat-support-lead.md)[Community Success Manager →](https://jobicy.com/salaries/au/community-success-manager.md)[Customer Experience Analyst →](https://jobicy.com/salaries/au/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/au/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/au/customer-intelligence-analyst.md)[Customer Success Director →](https://jobicy.com/salaries/au/customer-success-director.md)[Customer Success Manager →](https://jobicy.com/salaries/au/customer-success-manager.md)[Customer Support Specialist →](https://jobicy.com/salaries/au/customer-support-specialist.md)[Gaming Community Manager →](https://jobicy.com/salaries/au/gaming-community-manager.md)[Implementation Consultant →](https://jobicy.com/salaries/au/implementation-consultant.md)[Mental Health Counselor →](https://jobicy.com/salaries/au/mental-health-counselor.md)[Partner Success Manager →](https://jobicy.com/salaries/au/partner-success-manager.md)[Platform Support Specialist →](https://jobicy.com/salaries/au/platform-support-specialist.md)[Support Knowledge Manager →](https://jobicy.com/salaries/au/support-knowledge-manager.md)[Technical Support Engineer →](https://jobicy.com/salaries/au/technical-support-engineer.md)[Technical Support Manager →](https://jobicy.com/salaries/au/technical-support-manager.md)Market intelligence

## Hiring context for Support Quality Analyst in Australia.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Very High

Current hiring-demand signal for this role across the tracked market.

Growth

### 25% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Very High

Evolution of remote collaboration practices incorporating AI-powered productivity tools and virtual reality meetings

###

Key industries

Software as a ServiceE-commerceFinTechConsumer TechnologyHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Support Quality Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$53,40020% lower](https://jobicy.com/salaries/ae/support-quality-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$39,20041% lower](https://jobicy.com/salaries/at/support-quality-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$45,70031% lower](https://jobicy.com/salaries/be/support-quality-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$66,8000% higher](https://jobicy.com/salaries/ca/support-quality-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$88,80033% higher](https://jobicy.com/salaries/ch/support-quality-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$56,30016% lower](https://jobicy.com/salaries/de/support-quality-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$31,40053% lower](https://jobicy.com/salaries/es/support-quality-analyst.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$43,30035% lower](https://jobicy.com/salaries/fr/support-quality-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Support Quality Analyst salary in Australia?

The estimated average annual salary is $66,700. Junior roles are estimated at $38,700–$52,200, while senior roles are estimated at $83,100–$123,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $20.84 and $49.70 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Technical troubleshooting, Case ownership, Escalation management, Knowledge writing, Customer communication. Trending and emerging requirements include Support operations analytics, Omnichannel support, AI-assisted service, Customer health scoring, Self-service design.

What is the market outlook?

Jobicy currently classifies demand as Very High, with a growth signal of 25% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Support Quality Analyst in Australia, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Australia and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Support Quality Analyst in Australia, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Support%20Quality%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)