[Salaries in Australia](https://jobicy.com/salaries/au.md)2026 Salary Report

# Video Editor salary in Australia.

The average salary for Video Editor in Australia is $65,500 per year, according to Jobicy salary data updated 12 Oct 2026. Entry-level positions start around $40,800–$54,600, while experienced professionals earn $80,000–$119,400.
Average compensation has increased 1.1% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 12 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$65,500Estimated annual average$3,712Estimated monthly take-home$20.47–$48.81Hourly equivalent range12 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Video Editor role shapes raw footage, audio, graphics, pacing, and narrative into polished video for a defined audience. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarity. For Australia, this report combines salary benchmarks in AUD with modeled assumptions for a 32% tax rate, 20 days of annual leave, and a 85.0 cost-of-living index relative to the United States baseline.

High accuracy1800 recent job listings and community reports shaped this estimateUpdated 12 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$65,500Annual benchmarkJunior$40,800–$54,6000-2 yearsMid-level$53,400–$79,2003-5 yearsSenior$80,000–$119,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 32% tax rate$3,712Hourly equivalentBased on a standard 40-hour week$20.47–$48.81Potential annual bonusIllustrative 10–15% performance range$6,550–$9,825

### Planning reference

Monthly savings target28% illustrative allocation$1,500Retirement contribution13% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$16,375–$32,750

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 32% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Video Editor pay in Australia.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Video Editor in Australia](https://jobicy.com/api/jpgraph/chart.php?junior_min=40800&junior_max=54600&middle_min=53400&middle_max=79200&senior_min=80000&senior_max=119400&average=65500&currency=%24&currency_code=USD&title=Video%20Editor&country=Australia)
Salary ranges

Enlarge
![Salary progression by experience for Video Editor in Australia](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=47700&m_avg=66300&s_avg=99700&currency=%24&currency_code=USD&title=Video%20Editor&country=Australia)
Experience growthEnlarge
![Illustrative monthly salary allocation for Video Editor in Australia](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1747&savings=1523&retirement=721&housing=1092&disposable=377&currency=%24&currency_code=USD&title=Video%20Editor&country=Australia)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.1% over the displayed period, moving from $64,800 to $65,500.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$65,500$20–$49Sep 2026$66,100$21–$49Aug 2026$65,600$21–$49Jul 2026$63,600$20–$47Jun 2026$64,500$20–$48May 2026$66,200$21–$49Apr 2026$65,200$20–$49Mar 2026$65,400$20–$49Feb 2026$64,300$20–$48Jan 2026$66,400$21–$49Dec 2025$62,400$20–$47Nov 2025$64,800$20–$48Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Fleetio logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2023/07/e571b83c37e0ed5371754d319be16e76.jpeg) Senior Director, Brand MarketingFleetio→](https://jobicy.com/jobs/155355-senior-director-brand-marketing.md) [![Deloitte logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/09/370c2482dacb3fffbd4043cfca5674fe.png) Senior Editor, AI and Technology, Deloitte Global InsightsDeloitte→](https://jobicy.com/jobs/149141-senior-editor-ai-and-technology-deloitte-global-insights.md) [![Solace logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4e37a66b-221.png) Performance Creative ManagerSolace→](https://jobicy.com/jobs/155204-performance-creative-manager.md) [![Kalshi logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/00635b6c-221.png) Video EditorKalshi→](https://jobicy.com/jobs/155198-video-editor.md) [![Atomic logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/11/dfb1cc8654c3b08bce1117b36f882000.png) Head of Brand & CreativeAtomic→](https://jobicy.com/jobs/155002-head-of-brand-creative-2.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Video%20Editor.md)Career profile

## Pay drivers and skills for Video Editor.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Nonlinear editingColor correctionAudio editingStory structureVisual communicationDesign systems

### Education requirements

A degree in design, visual communication, interaction design, or an equivalent professional portfolioA portfolio that explains process, constraints, iteration, and measurable outcomes rather than only final visuals

### Training and development

Design-system contribution workshopsResearch synthesis practiceAdvanced prototyping labsAccessibility and inclusive design reviewsFacilitated critique sessions

### Core skills

Nonlinear editingColor correctionAudio editingStory structureVisual communicationDesign systemsPrototypingUser-centered designAccessibility

### Trending and emerging skills

AI-assisted creative workflowsResponsive systemsInclusive designDesign operationsMotion principlesSpatial interfacesGenerative design systemsMultimodal prototypingReal-time 3D experiences

### Key responsibilities

Own the planning and delivery of work in the Video Editor remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarityCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Portfolio quality and demonstrated outcomesProduct or brand complexityResearch and accessibility capabilityDesign-system ownershipAdvanced production-tool expertiseScope of creative direction and stakeholder influence

### Typical career path

Junior content or editorial roleVideo EditorSenior Video EditorContent strategy, editorial leadership, brand communication, or independent practice

### Work specifics

Remote creative team using shared design systems, documented feedback, and frequent prototype reviewsWorks closely with research, product, engineering, content, marketing, and brand stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responsePremiere ProDaVinci ResolveAfter EffectsFigmaAdobe Creative CloudMiroNotionPrototyping tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[3D Artist →](https://jobicy.com/salaries/au/3d-artist.md)[Animation Director →](https://jobicy.com/salaries/au/animation-director.md)[AR/VR Designer →](https://jobicy.com/salaries/au/ar-vr-designer.md)[Content Designer →](https://jobicy.com/salaries/au/content-designer.md)[Creative Director →](https://jobicy.com/salaries/au/creative-director.md)[Data Visualization Specialist →](https://jobicy.com/salaries/au/data-visualization-specialist.md)[Digital Product Designer →](https://jobicy.com/salaries/au/digital-product-designer.md)[Instructional Designer →](https://jobicy.com/salaries/au/instructional-designer.md)[Learning Experience Designer →](https://jobicy.com/salaries/au/learning-experience-designer.md)[Motion Designer →](https://jobicy.com/salaries/au/motion-designer.md)[Multimedia Producer →](https://jobicy.com/salaries/au/multimedia-producer.md)[Podcast Producer →](https://jobicy.com/salaries/au/podcast-producer.md)[Service Design Manager →](https://jobicy.com/salaries/au/service-design-manager.md)[Social Content Producer →](https://jobicy.com/salaries/au/social-content-producer.md)[User Research Manager →](https://jobicy.com/salaries/au/user-research-manager.md)[UX Designer →](https://jobicy.com/salaries/au/ux-designer.md)Market intelligence

## Hiring context for Video Editor in Australia.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Adoption of sophisticated project management tools and productivity tracking systems for remote teams

###

Key industries

Media and EntertainmentAdvertisingCreator EconomyDigital AgenciesCross-country pay scale

## Compare Video Editor pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$51,90021% lower](https://jobicy.com/salaries/ae/video-editor.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$38,60041% lower](https://jobicy.com/salaries/at/video-editor.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$47,00028% lower](https://jobicy.com/salaries/be/video-editor.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$62,2005% lower](https://jobicy.com/salaries/ca/video-editor.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$86,80033% higher](https://jobicy.com/salaries/ch/video-editor.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$56,30014% lower](https://jobicy.com/salaries/de/video-editor.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$31,30052% lower](https://jobicy.com/salaries/es/video-editor.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$43,40034% lower](https://jobicy.com/salaries/fr/video-editor.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Video Editor salary in Australia?

The estimated average annual salary is $65,500. Junior roles are estimated at $40,800–$54,600, while senior roles are estimated at $80,000–$119,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $20.47 and $48.81 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Nonlinear editing, Color correction, Audio editing, Story structure, Visual communication. Trending and emerging requirements include AI-assisted creative workflows, Responsive systems, Inclusive design, Design operations, Motion principles.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Video Editor in Australia, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Australia and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Video Editor in Australia, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Video%20Editor.md)[Salary API](https://jobicy.com/salary-api.md)