[Salaries in Belgium](https://jobicy.com/salaries/be.md)2026 Salary Report

# Business Development Manager salary in Belgium.

The core purpose of a Business Development Manager is practical: the professional finds and develops commercial opportunities through partnerships, market insight, and structured deal work. Day-to-day priorities vary by company, but performance is generally visible in revenue, win rate, pipeline coverage, forecast accuracy, deal quality, and customer fit. For Belgium, this report combines salary benchmarks in EUR with modeled assumptions for a 50% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$63,200Estimated annual average$2,633Estimated monthly take-home$19.75–$47.10Hourly equivalent range4 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy422 recent job listings and community reports shaped this estimateUpdated 4 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$63,200Annual benchmarkJunior$39,600–$52,1000-2 yearsMid-level$49,400–$77,0003-5 yearsSenior$78,200–$109,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 50% tax rate$2,633Hourly equivalentBased on a standard 40-hour week$19.75–$47.10Potential annual bonusIllustrative 10–15% performance range$6,320–$9,480

### Planning reference

Monthly savings target29% illustrative allocation$1,500Retirement contribution16% illustrative allocation$800Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$15,800–$31,600

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 50% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Business Development Manager pay in Belgium.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Business Development Manager in Belgium](https://jobicy.com/api/jpgraph/chart.php?junior_min=39600&junior_max=52100&middle_min=49400&middle_max=77000&senior_min=78200&senior_max=109300&average=63200&currency=%24&currency_code=USD&title=Business%20Development%20Manager&country=Belgium)
Salary ranges

Enlarge
![Salary progression by experience for Business Development Manager in Belgium](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=45850&m_avg=63200&s_avg=93750&currency=%24&currency_code=USD&title=Business%20Development%20Manager&country=Belgium)
Experience growthEnlarge
![Illustrative monthly salary allocation for Business Development Manager in Belgium](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2633&savings=1548&retirement=843&housing=1053&disposable=0&currency=%24&currency_code=USD&title=Business%20Development%20Manager&country=Belgium)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 6% over the displayed period, moving from $59,600 to $63,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$63,200$20–$47Sep 2026$61,800$19–$46Aug 2026$64,000$20–$48Jul 2026$62,500$20–$47Jun 2026$61,500$19–$46May 2026$61,300$19–$46Apr 2026$58,500$18–$44Mar 2026$59,800$19–$45Feb 2026$60,000$19–$45Jan 2026$60,200$19–$45Dec 2025$57,700$18–$43Nov 2025$59,600$19–$44Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Launch Potato logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/30f8890f-221-1.png) Lead BI ManagerLaunch Potato→](https://jobicy.com/jobs/155160-lead-bi-manager-2.md) [![Launch Potato logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/30f8890f-221-1.png) Lead Analytics ManagerLaunch Potato→](https://jobicy.com/jobs/155158-lead-analytics-manager-2.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Business Development Executive, Financial Institutions (EMEA)TRM Labs→](https://jobicy.com/jobs/155139-business-development-executive-financial-institutions-emea.md) [![Huntress logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/91eae3ae-221.jpg) Manager, Security Operations Center - EMEAHuntress→](https://jobicy.com/jobs/155134-manager-security-operations-center-emea.md) [![OKX logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/c6a69151-221-1.png) Affiliates Business Development Manager - GermanyOKX→](https://jobicy.com/jobs/155123-affiliates-business-development-manager-germany.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Business%20Development%20Manager.md)Career profile

## Pay drivers and skills for Business Development Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

DiscoveryConsultative sellingPipeline managementNegotiationAccount planningCRM discipline

### Education requirements

A degree in business, communications, or equivalent evidence of consultative selling experienceDemonstrated ability to qualify opportunities, understand customer economics, and manage a disciplined sales process

### Training and development

Negotiation simulationsProduct and industry certificationForecast accuracy reviewsAccount-planning workshopsDiscovery-call coaching

### Core skills

DiscoveryConsultative sellingPipeline managementNegotiationAccount planningCRM disciplineForecastingCommercial communication

### Trending and emerging skills

Revenue intelligenceProduct-led salesIntent dataDigital sales roomsAI-assisted prospect researchBuyer-signal orchestrationConversation intelligenceUsage-based commercial modelsAutomated account research

### Key responsibilities

Own the planning and delivery of work in the Business Development Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against revenue, win rate, pipeline coverage, forecast accuracy, deal quality, and customer fitCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipQuota and revenue responsibilityAverage deal size and sales-cycle complexityTerritory and account qualityIndustry and product expertiseConsistent attainment and forecast accuracy

### Typical career path

Senior individual contributor or team leadBusiness Development ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote commercial team with defined territories, CRM-based workflows, regular deal reviews, and measurable pipeline stagesCoordinates with marketing, solutions, product, finance, legal, and customer success throughout the buying journeyRequires dependable overlap with assigned customer territories for discovery, demonstrations, negotiation, and deal coordinationSalesforceHubSpotLinkedIn Sales NavigatorZoomGongProposal softwareForecasting tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/be/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/be/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/be/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/be/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/be/business-analyst.md)[Change Management Consultant →](https://jobicy.com/salaries/be/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/be/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/be/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/be/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/be/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/be/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/be/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/be/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/be/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/be/customer-success-director.md)[Customer Success Manager →](https://jobicy.com/salaries/be/customer-success-manager.md)Market intelligence

## Hiring context for Business Development Manager in Belgium.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Rising demand for remote-first positions with enhanced digital security measures and virtual onboarding processes

###

Key industries

Software as a ServiceCloud ComputingFinTechCybersecurityBusiness ServicesData PlatformsCross-country pay scale

## Compare Business Development Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$72,10014% higher](https://jobicy.com/salaries/ae/business-development-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$54,90013% lower](https://jobicy.com/salaries/at/business-development-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$86,50037% higher](https://jobicy.com/salaries/au/business-development-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$85,10035% higher](https://jobicy.com/salaries/ca/business-development-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$117,20085% higher](https://jobicy.com/salaries/ch/business-development-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$72,40015% higher](https://jobicy.com/salaries/de/business-development-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$41,40034% lower](https://jobicy.com/salaries/es/business-development-manager.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$55,20013% lower](https://jobicy.com/salaries/fr/business-development-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Business Development Manager salary in Belgium?

The estimated average annual salary is $63,200. Junior roles are estimated at $39,600–$52,100, while senior roles are estimated at $78,200–$109,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $19.75 and $47.10 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Discovery, Consultative selling, Pipeline management, Negotiation, Account planning. Trending and emerging requirements include Revenue intelligence, Product-led sales, Intent data, Digital sales rooms, AI-assisted prospect research.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Business Development Manager in Belgium, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Belgium and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Business Development Manager in Belgium, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Business%20Development%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)