[Salaries in Belgium](https://jobicy.com/salaries/be.md)2026 Salary Report

# Content Strategist salary in Belgium.

The average salary for Content Strategist in Belgium is $57,700 per year, according to Jobicy salary data updated 5 Oct 2026. Entry-level positions start around $35,200–$46,400, while experienced professionals earn $70,400–$106,100.
Average compensation has decreased 1.9% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 5 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$57,700Estimated annual average$2,404Estimated monthly take-home$18.03–$43.00Hourly equivalent range5 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Content Strategist role plans content around audience needs, business goals, distribution, governance, and measurable lifecycle value. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contribution. For Belgium, this report combines salary benchmarks in EUR with modeled assumptions for a 50% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

Reliable accuracy443 recent job listings and community reports shaped this estimateUpdated 5 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$57,700Annual benchmarkJunior$35,200–$46,4000-2 yearsMid-level$46,700–$71,5003-5 yearsSenior$70,400–$106,1006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 50% tax rate$2,404Hourly equivalentBased on a standard 40-hour week$18.03–$43.00Potential annual bonusIllustrative 10–15% performance range$5,770–$8,655

### Planning reference

Monthly savings target26% illustrative allocation$1,200Retirement contribution13% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $1,000Emergency fundThree to six months of gross income$14,425–$28,850

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 50% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Content Strategist pay in Belgium.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Content Strategist in Belgium](https://jobicy.com/api/jpgraph/chart.php?junior_min=35200&junior_max=46400&middle_min=46700&middle_max=71500&senior_min=70400&senior_max=106100&average=57700&currency=%24&currency_code=USD&title=Content%20Strategist&country=Belgium)
Salary ranges

Enlarge
![Salary progression by experience for Content Strategist in Belgium](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=40800&m_avg=59100&s_avg=88250&currency=%24&currency_code=USD&title=Content%20Strategist&country=Belgium)
Experience growthEnlarge
![Illustrative monthly salary allocation for Content Strategist in Belgium](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2404&savings=1231&retirement=611&housing=962&disposable=0&currency=%24&currency_code=USD&title=Content%20Strategist&country=Belgium)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.9% over the displayed period, moving from $58,800 to $57,700.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$57,700$18–$43Sep 2026$58,500$18–$44Aug 2026$60,300$19–$45Jul 2026$57,000$18–$42Jun 2026$56,800$18–$42May 2026$59,300$19–$44Apr 2026$57,500$18–$43Mar 2026$58,800$18–$44Feb 2026$59,600$19–$44Jan 2026$58,900$18–$44Dec 2025$57,200$18–$43Nov 2025$58,800$18–$44Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Deloitte logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/09/370c2482dacb3fffbd4043cfca5674fe.png) Senior Editor, AI and Technology, Deloitte Global InsightsDeloitte→](https://jobicy.com/jobs/149141-senior-editor-ai-and-technology-deloitte-global-insights.md) [![Solace logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/4e37a66b-221.png) Performance Creative ManagerSolace→](https://jobicy.com/jobs/155204-performance-creative-manager.md) [![Instrument logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/4bad3e7b155943ebf27d1da56ae2e258.jpg) Senior Strategist / Strategy Lead (contract)Instrument→](https://jobicy.com/jobs/152911-senior-strategist-strategy-lead-contract.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Content%20Strategist.md)Career profile

## Pay drivers and skills for Content Strategist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Editorial judgmentContent operationsVoice and toneFact-checkingAudience researchPositioning

### Education requirements

A degree in marketing, communications, business, or equivalent evidence of successful campaign workWorking knowledge of audience research, positioning, measurement, experimentation, and responsible data use

### Training and development

Privacy and consent trainingConversion research practiceMessage testing labsMarketing automation exercisesMeasurement-plan workshops

### Professional certifications

Google Analytics certification

### Core skills

Editorial judgmentContent operationsVoice and toneFact-checkingAudience researchPositioningCampaign planningCopywritingAnalytics

### Trending and emerging skills

Lifecycle marketingFirst-party data strategyMarketing automationIncrementality testingAI-assisted content operationsGenerative search optimizationPrivacy-preserving attributionSynthetic audience researchConversational discovery

### Key responsibilities

Own the planning and delivery of work in the Content Strategist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contributionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Portfolio quality and subject-matter depthAudience reach and publishing responsibilityEditorial governance and content-performance ownershipChannel budget and revenue responsibilityDemonstrated acquisition or retention impactAnalytics and experimentation depthMarket and audience complexity

### Typical career path

Junior content or editorial roleContent StrategistSenior Content StrategistContent strategy, editorial leadership, brand communication, or independent practice

### Work specifics

Distributed marketing team working from campaign briefs, shared calendars, experimentation plans, and performance dashboardsPartners with sales, product, design, content, data, customer teams, and external specialistsUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGoogle Analytics 4HubSpotAhrefsSemrushLooker StudioCRM platformsProject tracking

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowancePerformance BonusesConference Attendance SupportMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/be/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/be/affiliate-program-manager.md)[AI Content Editor →](https://jobicy.com/salaries/be/ai-content-editor.md)[Brand Content Strategist →](https://jobicy.com/salaries/be/brand-content-strategist.md)[Brand Strategist →](https://jobicy.com/salaries/be/brand-strategist.md)[Content Designer →](https://jobicy.com/salaries/be/content-designer.md)[Content Optimization Lead →](https://jobicy.com/salaries/be/content-optimization-lead.md)[Content Quality Manager →](https://jobicy.com/salaries/be/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/be/conversion-optimization-manager.md)[Conversion Rate Specialist →](https://jobicy.com/salaries/be/conversion-rate-specialist.md)[Copywriter →](https://jobicy.com/salaries/be/copywriter.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/be/customer-acquisition-manager.md)[Digital Campaign Manager →](https://jobicy.com/salaries/be/digital-campaign-manager.md)[Digital Marketing Manager →](https://jobicy.com/salaries/be/digital-marketing-manager.md)[Digital Marketing Strategist →](https://jobicy.com/salaries/be/digital-marketing-strategist.md)[E-commerce Manager →](https://jobicy.com/salaries/be/e-commerce-manager.md)Market intelligence

## Hiring context for Content Strategist in Belgium.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Increasing remote opportunities with quarterly team meetups and annual company gatherings for maintaining team cohesion

###

Key industries

Software as a ServiceE-commerceMedia and PublishingConsumer ProductsFinTechDigital AgenciesCross-country pay scale

## Compare Content Strategist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$69,60021% higher](https://jobicy.com/salaries/ae/content-strategist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$51,30011% lower](https://jobicy.com/salaries/at/content-strategist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$83,70045% higher](https://jobicy.com/salaries/au/content-strategist.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$80,80040% higher](https://jobicy.com/salaries/ca/content-strategist.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$107,40086% higher](https://jobicy.com/salaries/ch/content-strategist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$70,70023% higher](https://jobicy.com/salaries/de/content-strategist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$40,80029% lower](https://jobicy.com/salaries/es/content-strategist.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$52,8008% lower](https://jobicy.com/salaries/fr/content-strategist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Content Strategist salary in Belgium?

The estimated average annual salary is $57,700. Junior roles are estimated at $35,200–$46,400, while senior roles are estimated at $70,400–$106,100.

What is the hourly rate for this role?

The estimated hourly equivalent is between $18.03 and $43.00 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Editorial judgment, Content operations, Voice and tone, Fact-checking, Audience research. Trending and emerging requirements include Lifecycle marketing, First-party data strategy, Marketing automation, Incrementality testing, AI-assisted content operations.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Content Strategist in Belgium, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Belgium and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Content Strategist in Belgium, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Content%20Strategist.md)[Salary API](https://jobicy.com/salary-api.md)