[Salaries in Belgium](https://jobicy.com/salaries/be.md)2026 Salary Report

# Data Engineer salary in Belgium.

The average salary for Data Engineer in Belgium is $83,400 per year, according to Jobicy salary data updated 12 Oct 2026. Entry-level positions start around $49,400–$69,800, while experienced professionals earn $97,700–$155,300.
Average compensation has increased 0.5% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 12 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$83,400Estimated annual average$3,475Estimated monthly take-home$26.06–$62.15Hourly equivalent range12 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Data Engineer role builds reliable data pipelines, models, orchestration, and quality controls for analytics and products. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For Belgium, this report combines salary benchmarks in EUR with modeled assumptions for a 50% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

High accuracy589 recent job listings and community reports shaped this estimateUpdated 12 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$83,400Annual benchmarkJunior$49,400–$69,8000-2 yearsMid-level$67,500–$102,6003-5 yearsSenior$97,700–$155,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 50% tax rate$3,475Hourly equivalentBased on a standard 40-hour week$26.06–$62.15Potential annual bonusIllustrative 10–15% performance range$8,340–$12,510

### Planning reference

Monthly savings target27% illustrative allocation$1,900Retirement contribution14% illustrative allocation$1,000Housing budgetIllustrative 20% monthly ceilingUp to $1,400Emergency fundThree to six months of gross income$20,850–$41,700

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 50% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Data Engineer pay in Belgium.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Data Engineer in Belgium](https://jobicy.com/api/jpgraph/chart.php?junior_min=49400&junior_max=69800&middle_min=67500&middle_max=102600&senior_min=97700&senior_max=155300&average=83400&currency=%24&currency_code=USD&title=Data%20Engineer&country=Belgium)
Salary ranges

Enlarge
![Salary progression by experience for Data Engineer in Belgium](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=59600&m_avg=85050&s_avg=126500&currency=%24&currency_code=USD&title=Data%20Engineer&country=Belgium)
Experience growthEnlarge
![Illustrative monthly salary allocation for Data Engineer in Belgium](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=3475&savings=1883&retirement=952&housing=1390&disposable=0&currency=%24&currency_code=USD&title=Data%20Engineer&country=Belgium)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 0.5% over the displayed period, moving from $83,000 to $83,400.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$83,400$26–$62Sep 2026$80,500$25–$60Aug 2026$85,500$27–$64Jul 2026$82,600$26–$62Jun 2026$81,700$26–$61May 2026$84,500$26–$63Apr 2026$82,900$26–$62Mar 2026$78,600$25–$59Feb 2026$78,600$25–$59Jan 2026$82,500$26–$61Dec 2025$79,600$25–$59Nov 2025$83,000$26–$62Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Supabase logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/611d3bfa-221.png) Postgres EngineerSupabase→](https://jobicy.com/jobs/153321-postgres-engineer.md) [![TE Connectivity logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/07/44e3e9132b6f-221.webp) ANALYST DIGITAL MARKETING IV (Remote) IVTE Connectivity→](https://jobicy.com/jobs/150674-analyst-digital-marketing-iv-remote-iv.md) [![TE Connectivity logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/07/44e3e9132b6f-221.webp) Account Manager IV (Remote in Bay Area, CA)TE Connectivity→](https://jobicy.com/jobs/150672-account-manager-iv-remote-in-bay-area-ca.md) [![Quantum Metric logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/52363ead-221.jpg) Solutions Engineer - USQuantum Metric→](https://jobicy.com/jobs/153333-solutions-engineer-us.md) [![Toptal logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/346ce7fb-221.png) SVP, ProductToptal→](https://jobicy.com/jobs/153312-svp-product.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Engineer.md)Career profile

## Pay drivers and skills for Data Engineer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 4-7 years of directly relevant experience supported by evidence of independent, high-impact delivery

### Required skills

Data pipelinesOrchestrationData warehousesSchema designSQLData analysis

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Advanced SQL and query optimizationData governance workshopsExperiment design practiceDashboard accessibility reviewsPrivacy-aware analytics training

### Core skills

Data pipelinesOrchestrationData warehousesSchema designSQLData analysisStatisticsData qualityData modeling

### Trending and emerging skills

Analytics engineeringData governanceSemantic layersSelf-service analyticsModern data stacksVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Data Engineer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsData volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experience

### Typical career path

Entry-level or associate role in the disciplineData EngineerSenior Data EngineerLead analyst, analytics management, data science, or data-platform leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeTableauPower BIGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/be/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/be/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/be/analytics-implementation-manager.md)[API Integration Specialist →](https://jobicy.com/salaries/be/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/be/automation-engineer.md)[Blockchain Analyst →](https://jobicy.com/salaries/be/blockchain-analyst.md)[Blockchain Developer →](https://jobicy.com/salaries/be/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/be/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/be/blockchain-security-analyst.md)[Business Analyst →](https://jobicy.com/salaries/be/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/be/business-intelligence-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/be/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/be/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/be/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/be/cplusplus-developer.md)[Customer Experience Analyst →](https://jobicy.com/salaries/be/customer-experience-analyst.md)Market intelligence

## Hiring context for Data Engineer in Belgium.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Expanding global remote workforce supported by investment in virtual team building and online social engagement

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Data Engineer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$93,20012% higher](https://jobicy.com/salaries/ae/data-engineer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$70,00016% lower](https://jobicy.com/salaries/at/data-engineer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$115,80039% higher](https://jobicy.com/salaries/au/data-engineer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$119,20043% higher](https://jobicy.com/salaries/ca/data-engineer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$160,10092% higher](https://jobicy.com/salaries/ch/data-engineer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$97,00016% higher](https://jobicy.com/salaries/de/data-engineer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$56,20033% lower](https://jobicy.com/salaries/es/data-engineer.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$74,00011% lower](https://jobicy.com/salaries/fr/data-engineer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Data Engineer salary in Belgium?

The estimated average annual salary is $83,400. Junior roles are estimated at $49,400–$69,800, while senior roles are estimated at $97,700–$155,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $26.06 and $62.15 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Data pipelines, Orchestration, Data warehouses, Schema design, SQL. Trending and emerging requirements include Analytics engineering, Data governance, Semantic layers, Self-service analytics, Modern data stacks.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Data Engineer in Belgium, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Belgium and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Data Engineer in Belgium, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Engineer.md)[Salary API](https://jobicy.com/salary-api.md)