[Salaries in Belgium](https://jobicy.com/salaries/be.md)2026 Salary Report

# Data Governance Specialist salary in Belgium.

The average salary for Data Governance Specialist in Belgium is $61,000 per year, according to Jobicy salary data updated 6 Oct 2026. Entry-level positions start around $38,200–$47,500, while experienced professionals earn $75,700–$113,800.
Average compensation has increased 4.8% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 6 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$61,000Estimated annual average$2,542Estimated monthly take-home$19.06–$45.46Hourly equivalent range6 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

In a remote organization, a Data Governance Specialist defines ownership, quality, access, lineage, retention, and policy for trustworthy organizational data. The position rewards independent ownership, documented reasoning, and continuous improvement across control effectiveness, remediation quality, audit readiness, regulatory timeliness, risk reduction, and decision clarity. For Belgium, this report combines salary benchmarks in EUR with modeled assumptions for a 50% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

High accuracy684 recent job listings and community reports shaped this estimateUpdated 6 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$61,000Annual benchmarkJunior$38,200–$47,5000-2 yearsMid-level$48,400–$73,9003-5 yearsSenior$75,700–$113,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 50% tax rate$2,542Hourly equivalentBased on a standard 40-hour week$19.06–$45.46Potential annual bonusIllustrative 10–15% performance range$6,100–$9,150

### Planning reference

Monthly savings target33% illustrative allocation$1,700Retirement contribution15% illustrative allocation$800Housing budgetIllustrative 20% monthly ceilingUp to $1,000Emergency fundThree to six months of gross income$15,250–$30,500

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 50% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Data Governance Specialist pay in Belgium.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Data Governance Specialist in Belgium](https://jobicy.com/api/jpgraph/chart.php?junior_min=38200&junior_max=47500&middle_min=48400&middle_max=73900&senior_min=75700&senior_max=113800&average=61000&currency=%24&currency_code=USD&title=Data%20Governance%20Specialist&country=Belgium)
Salary ranges

Enlarge
![Salary progression by experience for Data Governance Specialist in Belgium](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=42850&m_avg=61150&s_avg=94750&currency=%24&currency_code=USD&title=Data%20Governance%20Specialist&country=Belgium)
Experience growthEnlarge
![Illustrative monthly salary allocation for Data Governance Specialist in Belgium](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2542&savings=1672&retirement=763&housing=1017&disposable=0&currency=%24&currency_code=USD&title=Data%20Governance%20Specialist&country=Belgium)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.8% over the displayed period, moving from $58,200 to $61,000.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$61,000$19–$45Sep 2026$61,100$19–$46Aug 2026$59,600$19–$44Jul 2026$59,500$19–$44Jun 2026$59,600$19–$44May 2026$58,500$18–$44Apr 2026$61,100$19–$46Mar 2026$59,500$19–$44Feb 2026$59,500$19–$44Jan 2026$59,400$19–$44Dec 2025$58,600$18–$44Nov 2025$58,200$18–$43Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Thoughtworks logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/41d94d08-221.png) Business Development ManagerThoughtworks→](https://jobicy.com/jobs/150754-business-development-manager.md) [![Boulevard logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/12/a45167e12b0ed51058a884cf9cd0c76f.png) Onboarding ManagerBoulevard→](https://jobicy.com/jobs/155312-onboarding-manager-2.md) [![Cobalt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/7a1fbbfd-221.jpg) Senior GTM Systems & AI SpecialistCobalt→](https://jobicy.com/jobs/155196-senior-gtm-systems-ai-specialist.md) [![Montu UK logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/ebb2a836-221.png) Consultant Psychiatrist (Remote, Ireland)Montu UK→](https://jobicy.com/jobs/155080-consultant-psychiatrist-remote-ireland.md) [![Montu UK logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/ebb2a836-221.png) Consultant Neurologist (Remote, Ireland)Montu UK→](https://jobicy.com/jobs/155077-consultant-neurologist-remote-ireland.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Governance%20Specialist.md)Career profile

## Pay drivers and skills for Data Governance Specialist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Regulatory analysisPolicy designRisk assessmentControl designAudit evidenceIssue management

### Education requirements

A degree in law, public policy, information governance, risk, technology, or equivalent regulatory experienceDemonstrated ability to interpret obligations and translate them into proportionate, testable operational controls

### Training and development

Executive risk communication practiceRegulatory update briefingsControl-design workshopsAudit and evidence simulationsIncident and breach exercises

### Professional certifications

Relevant privacy, compliance, audit, or risk certification when applicable

### Core skills

Regulatory analysisPolicy designRisk assessmentControl designAudit evidenceIssue managementExecutive communicationCross-functional governance

### Trending and emerging skills

Continuous complianceAI governancePrivacy engineeringAutomated control testingThird-party risk managementMachine-readable regulationAlgorithmic accountabilityPrivacy-enhancing technologiesDigital identity assurance

### Key responsibilities

Own the planning and delivery of work in the Data Governance Specialist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against control effectiveness, remediation quality, audit readiness, regulatory timeliness, risk reduction, and decision clarityInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsRegulatory complexity and jurisdiction coverageControl and audit ownershipProfessional privacy, risk, or compliance credentialsMateriality of governed systems and dataExecutive and regulator interaction

### Typical career path

Entry-level or associate role in the disciplineData Governance SpecialistSenior Data Governance SpecialistSenior governance specialist, compliance leadership, privacy leadership, or risk management

### Work specifics

Independent governance function working through documented assessments, evidence, review forums, and confidential issue managementAdvises legal, security, data, product, engineering, finance, operations, and executive stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeGovernance platformsRisk registersPolicy repositoriesAudit workflow tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/be/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/be/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/be/analytics-implementation-manager.md)[Blockchain Analyst →](https://jobicy.com/salaries/be/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/be/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/be/business-intelligence-analyst.md)[Customer Experience Analyst →](https://jobicy.com/salaries/be/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/be/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/be/customer-intelligence-analyst.md)[Data Engineer →](https://jobicy.com/salaries/be/data-engineer.md)[Data Entry Specialist →](https://jobicy.com/salaries/be/data-entry-specialist.md)[Data Governance Manager →](https://jobicy.com/salaries/be/data-governance-manager.md)[Data Migration Specialist →](https://jobicy.com/salaries/be/data-migration-specialist.md)[Data Privacy Consultant →](https://jobicy.com/salaries/be/data-privacy-consultant.md)[Data Privacy Officer →](https://jobicy.com/salaries/be/data-privacy-officer.md)[Data Quality Analyst →](https://jobicy.com/salaries/be/data-quality-analyst.md)Market intelligence

## Hiring context for Data Governance Specialist in Belgium.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Evolution of remote collaboration practices incorporating AI-powered productivity tools and virtual reality meetings

###

Key industries

Financial ServicesHealthcare TechnologySoftware as a ServiceCybersecurityLegal ServicesGovernment TechnologyCross-country pay scale

## Compare Data Governance Specialist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$70,90016% higher](https://jobicy.com/salaries/ae/data-governance-specialist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$53,80012% lower](https://jobicy.com/salaries/at/data-governance-specialist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$86,30041% higher](https://jobicy.com/salaries/au/data-governance-specialist.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$87,50043% higher](https://jobicy.com/salaries/ca/data-governance-specialist.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$110,50081% higher](https://jobicy.com/salaries/ch/data-governance-specialist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$75,60024% higher](https://jobicy.com/salaries/de/data-governance-specialist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$41,90031% lower](https://jobicy.com/salaries/es/data-governance-specialist.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$56,0008% lower](https://jobicy.com/salaries/fr/data-governance-specialist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Data Governance Specialist salary in Belgium?

The estimated average annual salary is $61,000. Junior roles are estimated at $38,200–$47,500, while senior roles are estimated at $75,700–$113,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $19.06 and $45.46 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Regulatory analysis, Policy design, Risk assessment, Control design, Audit evidence. Trending and emerging requirements include Continuous compliance, AI governance, Privacy engineering, Automated control testing, Third-party risk management.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Data Governance Specialist in Belgium, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Belgium and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Data Governance Specialist in Belgium, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Governance%20Specialist.md)[Salary API](https://jobicy.com/salary-api.md)