[Salaries in Belgium](https://jobicy.com/salaries/be.md)2026 Salary Report

# Data Migration Specialist salary in Belgium.

The average salary for Data Migration Specialist in Belgium is $63,300 per year, according to Jobicy salary data updated 10 Oct 2026. Entry-level positions start around $37,000–$52,900, while experienced professionals earn $75,600–$118,600.
Average compensation has increased 1.4% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 10 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$63,300Estimated annual average$2,638Estimated monthly take-home$19.78–$47.17Hourly equivalent range10 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Data Migration Specialist role profiles, maps, transforms, validates, and reconciles data across system migrations. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For Belgium, this report combines salary benchmarks in EUR with modeled assumptions for a 50% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

High accuracy627 recent job listings and community reports shaped this estimateUpdated 10 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$63,300Annual benchmarkJunior$37,000–$52,9000-2 yearsMid-level$51,700–$74,8003-5 yearsSenior$75,600–$118,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 50% tax rate$2,638Hourly equivalentBased on a standard 40-hour week$19.78–$47.17Potential annual bonusIllustrative 10–15% performance range$6,330–$9,495

### Planning reference

Monthly savings target33% illustrative allocation$1,700Retirement contribution17% illustrative allocation$900Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$15,825–$31,650

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 50% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Data Migration Specialist pay in Belgium.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Data Migration Specialist in Belgium](https://jobicy.com/api/jpgraph/chart.php?junior_min=37000&junior_max=52900&middle_min=51700&middle_max=74800&senior_min=75600&senior_max=118600&average=63300&currency=%24&currency_code=USD&title=Data%20Migration%20Specialist&country=Belgium)
Salary ranges

Enlarge
![Salary progression by experience for Data Migration Specialist in Belgium](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=44950&m_avg=63250&s_avg=97100&currency=%24&currency_code=USD&title=Data%20Migration%20Specialist&country=Belgium)
Experience growthEnlarge
![Illustrative monthly salary allocation for Data Migration Specialist in Belgium](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2638&savings=1714&retirement=876&housing=1055&disposable=0&currency=%24&currency_code=USD&title=Data%20Migration%20Specialist&country=Belgium)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.4% over the displayed period, moving from $62,400 to $63,300.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$63,300$20–$47Sep 2026$65,200$20–$49Aug 2026$63,900$20–$48Jul 2026$62,600$20–$47Jun 2026$66,500$21–$50May 2026$63,300$20–$47Apr 2026$63,000$20–$47Mar 2026$61,900$19–$46Feb 2026$62,700$20–$47Jan 2026$61,600$19–$46Dec 2025$61,100$19–$46Nov 2025$62,400$20–$47Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Bloomreach logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/60790cd5-221.png) Senior Site Reliability Engineer for Fuse teamBloomreach→](https://jobicy.com/jobs/155362-senior-site-reliability-engineer-for-fuse-team.md) [![Autodesk logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/03/983ea436405fa9ab72f858e1f1b874a7.jpeg) Software ArchitectAutodesk→](https://jobicy.com/jobs/150381-software-architect.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Migration%20Specialist.md)Career profile

## Pay drivers and skills for Data Migration Specialist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

SQLData analysisStatisticsData qualityData modelingVisualization

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Privacy-aware analytics trainingAdvanced SQL and query optimizationData governance workshopsExperiment design practiceDashboard accessibility reviews

### Core skills

SQLData analysisStatisticsData qualityData modelingVisualizationExperimentationBusiness communication

### Trending and emerging skills

Semantic layersSelf-service analyticsModern data stacksAnalytics engineeringData governanceVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Data Migration Specialist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsData volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experience

### Typical career path

Entry-level or associate role in the disciplineData Migration SpecialistSenior Data Migration SpecialistLead analyst, analytics management, data science, or data-platform leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeTableauPower BIGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/be/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/be/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/be/analytics-implementation-manager.md)[API Integration Specialist →](https://jobicy.com/salaries/be/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/be/automation-engineer.md)[Blockchain Analyst →](https://jobicy.com/salaries/be/blockchain-analyst.md)[Blockchain Developer →](https://jobicy.com/salaries/be/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/be/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/be/blockchain-security-analyst.md)[Business Analyst →](https://jobicy.com/salaries/be/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/be/business-intelligence-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/be/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/be/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/be/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/be/cplusplus-developer.md)[Customer Experience Analyst →](https://jobicy.com/salaries/be/customer-experience-analyst.md)Market intelligence

## Hiring context for Data Migration Specialist in Belgium.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Expanding global remote workforce supported by investment in virtual team building and online social engagement

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Data Migration Specialist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$76,20020% higher](https://jobicy.com/salaries/ae/data-migration-specialist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$57,8009% lower](https://jobicy.com/salaries/at/data-migration-specialist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$92,30046% higher](https://jobicy.com/salaries/au/data-migration-specialist.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$93,50048% higher](https://jobicy.com/salaries/ca/data-migration-specialist.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$118,30087% higher](https://jobicy.com/salaries/ch/data-migration-specialist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$77,50022% higher](https://jobicy.com/salaries/de/data-migration-specialist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$46,80026% lower](https://jobicy.com/salaries/es/data-migration-specialist.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$58,1008% lower](https://jobicy.com/salaries/fr/data-migration-specialist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Data Migration Specialist salary in Belgium?

The estimated average annual salary is $63,300. Junior roles are estimated at $37,000–$52,900, while senior roles are estimated at $75,600–$118,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $19.78 and $47.17 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include SQL, Data analysis, Statistics, Data quality, Data modeling. Trending and emerging requirements include Semantic layers, Self-service analytics, Modern data stacks, Analytics engineering, Data governance.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Data Migration Specialist in Belgium, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Belgium and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Data Migration Specialist in Belgium, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Migration%20Specialist.md)[Salary API](https://jobicy.com/salary-api.md)