[Salaries in Belgium](https://jobicy.com/salaries/be.md)2026 Salary Report

# HR Manager salary in Belgium.

In a remote organization, an HR Manager runs dependable people operations while advising managers and supporting a fair employee experience. The position rewards independent ownership, documented reasoning, and continuous improvement across retention, engagement, hiring quality, workforce readiness, service quality, and program fairness. For Belgium, this report combines salary benchmarks in EUR with modeled assumptions for a 50% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$57,300Estimated annual average$2,388Estimated monthly take-home$17.91–$42.70Hourly equivalent range1 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy423 recent job listings and community reports shaped this estimateUpdated 1 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$57,300Annual benchmarkJunior$35,100–$44,9000-2 yearsMid-level$46,800–$70,3003-5 yearsSenior$70,700–$106,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 50% tax rate$2,388Hourly equivalentBased on a standard 40-hour week$17.91–$42.70Potential annual bonusIllustrative 10–15% performance range$5,730–$8,595

### Planning reference

Monthly savings target29% illustrative allocation$1,400Retirement contribution13% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $1,000Emergency fundThree to six months of gross income$14,325–$28,650

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 50% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to HR Manager pay in Belgium.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for HR Manager in Belgium](https://jobicy.com/api/jpgraph/chart.php?junior_min=35100&junior_max=44900&middle_min=46800&middle_max=70300&senior_min=70700&senior_max=106300&average=57300&currency=%24&currency_code=USD&title=HR%20Manager&country=Belgium)
Salary ranges

Enlarge
![Salary progression by experience for HR Manager in Belgium](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=40000&m_avg=58550&s_avg=88500&currency=%24&currency_code=USD&title=HR%20Manager&country=Belgium)
Experience growthEnlarge
![Illustrative monthly salary allocation for HR Manager in Belgium](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2388&savings=1390&retirement=635&housing=955&disposable=0&currency=%24&currency_code=USD&title=HR%20Manager&country=Belgium)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 7.7% over the displayed period, moving from $53,200 to $57,300.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$57,300$18–$43Sep 2026$56,800$18–$42Aug 2026$56,800$18–$42Jul 2026$54,900$17–$41Jun 2026$55,300$17–$41May 2026$56,600$18–$42Apr 2026$56,900$18–$42Mar 2026$54,300$17–$40Feb 2026$52,600$16–$39Jan 2026$53,800$17–$40Dec 2025$55,400$17–$41Nov 2025$53,200$17–$40Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Business Development Executive, Financial Institutions (EMEA)TRM Labs→](https://jobicy.com/jobs/155139-business-development-executive-financial-institutions-emea.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Marketing Technology EngineerTRM Labs→](https://jobicy.com/jobs/155143-marketing-technology-engineer-2.md) [![Huntress logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/91eae3ae-221.jpg) Security Operations Analyst- IrelandHuntress→](https://jobicy.com/jobs/155141-security-operations-analyst-ireland.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior Blockchain Intelligence Analyst, RansomwareTRM Labs→](https://jobicy.com/jobs/155136-senior-blockchain-intelligence-analyst-ransomware.md) [![Huntress logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/91eae3ae-221.jpg) Manager, Security Operations Center - EMEAHuntress→](https://jobicy.com/jobs/155134-manager-security-operations-center-emea.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=HR%20Manager.md)Career profile

## Pay drivers and skills for HR Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Employee relationsTalent practicesPolicy designCoachingWorkforce planningPeople analytics

### Education requirements

A degree in human resources, organizational psychology, business, or equivalent people-operations experienceWorking knowledge of fair employment practices, confidential data handling, and evidence-based people programs

### Training and development

Employment-practice updatesStructured interviewing workshopsCoaching and feedback practicePeople analytics labsInclusive program design

### Professional certifications

SHRM, CIPD, or equivalent when relevant

### Core skills

Employee relationsTalent practicesPolicy designCoachingWorkforce planningPeople analyticsChange communicationConfidentiality

### Trending and emerging skills

Employee listeningDistributed work designPeople analyticsInclusive talent systemsSkills-based organizationsAI governance in HRInternal talent marketplacesDynamic workforce planningPersonalized learning systems

### Key responsibilities

Own the planning and delivery of work in the HR Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against retention, engagement, hiring quality, workforce readiness, service quality, and program fairnessCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipWorkforce size and geographic complexityEmployee-relations and compliance exposureProgram or organization-wide ownershipPeople analytics and systems capabilityLeadership advisory responsibility

### Typical career path

Senior individual contributor or team leadHR ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote people team handling confidential information through consistent policies, documented processes, and employee-centered serviceAdvises employees, managers, executives, finance, legal, recruiting, and learning partnersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseHRISApplicant tracking systemsSurvey platformsLearning platformsSpreadsheetsNotionVideo conferencing

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/be/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/be/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/be/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/be/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/be/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/be/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/be/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/be/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/be/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/be/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/be/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/be/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/be/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/be/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/be/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/be/customer-success-director.md)Market intelligence

## Hiring context for HR Manager in Belgium.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Strong preference for flexible work arrangements including asynchronous communication and results-based performance evaluation

###

Key industries

Human Resources TechnologySoftware as a ServiceProfessional ServicesHealthcareFinancial ServicesE-commerceCross-country pay scale

## Compare HR Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$62,5009% higher](https://jobicy.com/salaries/ae/hr-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$49,50014% lower](https://jobicy.com/salaries/at/hr-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$79,70039% higher](https://jobicy.com/salaries/au/hr-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$76,50034% higher](https://jobicy.com/salaries/ca/hr-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$102,20078% higher](https://jobicy.com/salaries/ch/hr-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$68,20019% higher](https://jobicy.com/salaries/de/hr-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$39,40031% lower](https://jobicy.com/salaries/es/hr-manager.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$51,9009% lower](https://jobicy.com/salaries/fr/hr-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average HR Manager salary in Belgium?

The estimated average annual salary is $57,300. Junior roles are estimated at $35,100–$44,900, while senior roles are estimated at $70,700–$106,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $17.91 and $42.70 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Employee relations, Talent practices, Policy design, Coaching, Workforce planning. Trending and emerging requirements include Employee listening, Distributed work design, People analytics, Inclusive talent systems, Skills-based organizations.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for HR Manager in Belgium, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Belgium and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for HR Manager in Belgium, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=HR%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)