[Salaries in Canada](https://jobicy.com/salaries/ca.md)2026 Salary Report

# Automation Engineer salary in Canada.

In a remote organization, an Automation Engineer identifies repeatable work and implements dependable automations with controls, observability, and human review. The position rewards independent ownership, documented reasoning, and continuous improvement across reliability, delivery lead time, defect rate, maintainability, and user impact. For Canada, this report combines salary benchmarks in CAD with modeled assumptions for a 25% tax rate, 10 days of annual leave, and a 80.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$102,100Estimated annual average$6,381Estimated monthly take-home$31.91–$76.08Hourly equivalent range2 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1929 recent job listings and community reports shaped this estimateUpdated 2 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$102,100Annual benchmarkJunior$63,800–$78,6000-2 yearsMid-level$81,500–$122,9003-5 yearsSenior$123,500–$194,0006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 25% tax rate$6,381Hourly equivalentBased on a standard 40-hour week$31.91–$76.08Potential annual bonusIllustrative 10–15% performance range$10,210–$15,315

### Planning reference

Monthly savings target32% illustrative allocation$2,700Retirement contribution15% illustrative allocation$1,200Housing budgetIllustrative 20% monthly ceilingUp to $1,700Emergency fundThree to six months of gross income$25,525–$51,050

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 25% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Automation Engineer pay in Canada.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Automation Engineer in Canada](https://jobicy.com/api/jpgraph/chart.php?junior_min=63800&junior_max=78600&middle_min=81500&middle_max=122900&senior_min=123500&senior_max=194000&average=102100&currency=%24&currency_code=USD&title=Automation%20Engineer&country=Canada)
Salary ranges

Enlarge
![Salary progression by experience for Automation Engineer in Canada](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=71200&m_avg=102200&s_avg=158750&currency=%24&currency_code=USD&title=Automation%20Engineer&country=Canada)
Experience growthEnlarge
![Illustrative monthly salary allocation for Automation Engineer in Canada](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2127&savings=2748&retirement=1234&housing=1702&disposable=698&currency=%24&currency_code=USD&title=Automation%20Engineer&country=Canada)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 6.2% over the displayed period, moving from $96,100 to $102,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$102,100$32–$76Sep 2026$101,600$32–$76Aug 2026$98,800$31–$74Jul 2026$101,800$32–$76Jun 2026$101,000$32–$75May 2026$96,100$30–$72Apr 2026$95,800$30–$71Mar 2026$97,200$30–$72Feb 2026$98,200$31–$73Jan 2026$98,900$31–$74Dec 2025$92,900$29–$69Nov 2025$96,100$30–$72Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Marketing Technology EngineerTRM Labs→](https://jobicy.com/jobs/155143-marketing-technology-engineer-2.md) [![Huntress logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/91eae3ae-221.jpg) Manager, Security Operations Center - EMEAHuntress→](https://jobicy.com/jobs/155134-manager-security-operations-center-emea.md) [![Zone & Co logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/618aec90-221.png) GTM EngineerZone & Co→](https://jobicy.com/jobs/155142-gtm-engineer-4.md) [![Dataiku logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/5a9d57bf-221.webp) Infrastructure EngineerDataiku→](https://jobicy.com/jobs/155135-infrastructure-engineer-5.md) [![Discord logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/02/WRILS-210216185819-522054.jpg) Senior Software Engineer, Application SecurityDiscord→](https://jobicy.com/jobs/155131-senior-software-engineer-application-security.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Automation%20Engineer.md)Career profile

## Pay drivers and skills for Automation Engineer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Software designData structuresDebuggingTestingVersion controlAPI design

### Education requirements

A degree in computer science, software engineering, or equivalent production experienceEvidence of building, testing, and maintaining software beyond tutorial projects

### Training and development

Production architecture reviewsSecure development lifecycle workshopsPerformance profiling practiceIncident response simulationsCloud deployment labs

### Core skills

Software designData structuresDebuggingTestingVersion controlAPI designCode reviewTechnical documentation

### Trending and emerging skills

Continuous deliveryObservabilitySecure codingAI-assisted developmentCloud-native developmentPlatform engineeringSoftware supply-chain securityAgentic development workflowsEdge computing

### Key responsibilities

Own the planning and delivery of work in the Automation Engineer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against reliability, delivery lead time, defect rate, maintainability, and user impactCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

System scale and technical complexityDepth in the primary programming stackCloud, security, and reliability ownershipArchitecture and technical decision scopeProduction incident responsibilityMentoring and cross-team influence

### Typical career path

Entry-level or associate role in the disciplineAutomation EngineerSenior Automation EngineerStaff or principal engineering, architecture, or engineering management

### Work specifics

Remote engineering team working through reviewed code, automated tests, and documented technical decisionsWorks with product, design, quality, security, and infrastructure partners throughout deliveryUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGitGitHubDockerCI/CDPostmanSentryJira

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/ca/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/ca/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/ca/api-integration-specialist.md)[Blockchain Developer →](https://jobicy.com/salaries/ca/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/ca/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/ca/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/ca/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/ca/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/ca/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/ca/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/ca/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/ca/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/ca/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/ca/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/ca/devops-engineer.md)[Digital Forensics Analyst →](https://jobicy.com/salaries/ca/digital-forensics-analyst.md)Market intelligence

## Hiring context for Automation Engineer in Canada.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Very High

Current hiring-demand signal for this role across the tracked market.

Growth

### 25% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Very High

Evolution of remote collaboration practices incorporating AI-powered productivity tools and virtual reality meetings

###

Key industries

Software as a ServiceCloud ComputingFinTechE-commerceCybersecurityDeveloper ToolsCross-country pay scale

## Compare Automation Engineer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$82,60019% lower](https://jobicy.com/salaries/ae/automation-engineer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$59,40042% lower](https://jobicy.com/salaries/at/automation-engineer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$104,0002% higher](https://jobicy.com/salaries/au/automation-engineer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$70,90031% lower](https://jobicy.com/salaries/be/automation-engineer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$134,60032% higher](https://jobicy.com/salaries/ch/automation-engineer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$86,80015% lower](https://jobicy.com/salaries/de/automation-engineer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$48,40053% lower](https://jobicy.com/salaries/es/automation-engineer.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$62,10039% lower](https://jobicy.com/salaries/fr/automation-engineer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Automation Engineer salary in Canada?

The estimated average annual salary is $102,100. Junior roles are estimated at $63,800–$78,600, while senior roles are estimated at $123,500–$194,000.

What is the hourly rate for this role?

The estimated hourly equivalent is between $31.91 and $76.08 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Software design, Data structures, Debugging, Testing, Version control. Trending and emerging requirements include Continuous delivery, Observability, Secure coding, AI-assisted development, Cloud-native development.

What is the market outlook?

Jobicy currently classifies demand as Very High, with a growth signal of 25% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Automation Engineer in Canada, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Canada and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Automation Engineer in Canada, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Automation%20Engineer.md)[Salary API](https://jobicy.com/salary-api.md)