[Salaries in Canada](https://jobicy.com/salaries/ca.md)2026 Salary Report

# Email Marketing Strategist salary in Canada.

A successful Email Marketing Strategist builds permission-based email programs across acquisition, lifecycle messaging, testing, and deliverability. Rather than measuring activity alone, organizations usually evaluate the role through qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contribution. For Canada, this report combines salary benchmarks in CAD with modeled assumptions for a 25% tax rate, 10 days of annual leave, and a 80.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$75,600Estimated annual average$4,725Estimated monthly take-home$23.63–$56.34Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1290 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$75,600Annual benchmarkJunior$46,700–$59,8000-2 yearsMid-level$61,900–$90,9003-5 yearsSenior$91,200–$135,7006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 25% tax rate$4,725Hourly equivalentBased on a standard 40-hour week$23.63–$56.34Potential annual bonusIllustrative 10–15% performance range$7,560–$11,340

### Planning reference

Monthly savings target29% illustrative allocation$1,800Retirement contribution13% illustrative allocation$800Housing budgetIllustrative 20% monthly ceilingUp to $1,300Emergency fundThree to six months of gross income$18,900–$37,800

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 25% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Email Marketing Strategist pay in Canada.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Email Marketing Strategist in Canada](https://jobicy.com/api/jpgraph/chart.php?junior_min=46700&junior_max=59800&middle_min=61900&middle_max=90900&senior_min=91200&senior_max=135700&average=75600&currency=%24&currency_code=USD&title=Email%20Marketing%20Strategist&country=Canada)
Salary ranges

Enlarge
![Salary progression by experience for Email Marketing Strategist in Canada](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=53250&m_avg=76400&s_avg=113450&currency=%24&currency_code=USD&title=Email%20Marketing%20Strategist&country=Canada)
Experience growthEnlarge
![Illustrative monthly salary allocation for Email Marketing Strategist in Canada](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1575&savings=1802&retirement=800&housing=1260&disposable=863&currency=%24&currency_code=USD&title=Email%20Marketing%20Strategist&country=Canada)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.7% over the displayed period, moving from $72,200 to $75,600.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$75,600$24–$56Sep 2026$74,200$23–$55Aug 2026$71,900$22–$54Jul 2026$73,500$23–$55Jun 2026$73,900$23–$55May 2026$74,200$23–$55Apr 2026$71,000$22–$53Mar 2026$69,100$22–$51Feb 2026$72,500$23–$54Jan 2026$71,800$22–$54Dec 2025$69,400$22–$52Nov 2025$72,200$23–$54Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Twilio logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/10/WRILS-201023175858-722503.jpg) Director, Global CampaignsTwilio→](https://jobicy.com/jobs/154904-director-global-campaigns.md) [![Quantum Metric logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/52363ead-221.jpg) Vice President, Banking & Financial Services Industry LeaderQuantum Metric→](https://jobicy.com/jobs/152796-vice-president-banking-financial-services-industry-leader.md) [![Wpromote logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/08/e1003ec6a2d34525775d0bc7912ced79.jpg) Digital & Motion DesignerWpromote→](https://jobicy.com/jobs/154789-digital-motion-designer-2.md) [![Wpromote logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/08/e1003ec6a2d34525775d0bc7912ced79.jpg) Audience & Connections StrategistWpromote→](https://jobicy.com/jobs/154786-audience-connections-strategist.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Email%20Marketing%20Strategist.md)Career profile

## Pay drivers and skills for Email Marketing Strategist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

DeliverabilityLifecycle journeysSegmentationEmail experimentationAudience researchPositioning

### Education requirements

A degree in marketing, communications, business, or equivalent evidence of successful campaign workWorking knowledge of audience research, positioning, measurement, experimentation, and responsible data use

### Training and development

Conversion research practiceMessage testing labsMarketing automation exercisesMeasurement-plan workshopsPrivacy and consent training

### Professional certifications

Google Analytics certification

### Core skills

DeliverabilityLifecycle journeysSegmentationEmail experimentationAudience researchPositioningCampaign planningCopywritingAnalytics

### Trending and emerging skills

Lifecycle marketingFirst-party data strategyMarketing automationIncrementality testingAI-assisted content operationsGenerative search optimizationPrivacy-preserving attributionSynthetic audience researchConversational discovery

### Key responsibilities

Own the planning and delivery of work in the Email Marketing Strategist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contributionCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Managed media or campaign budgetRevenue attribution and experimentation maturityChannel budget and revenue responsibilityDemonstrated acquisition or retention impactAnalytics and experimentation depthMarket and audience complexityBrand or lifecycle ownership

### Typical career path

Marketing coordinator or channel specialistEmail Marketing StrategistSenior specialist or marketing leadMarketing management, growth leadership, or independent consulting

### Work specifics

Distributed marketing team working from campaign briefs, shared calendars, experimentation plans, and performance dashboardsPartners with sales, product, design, content, data, customer teams, and external specialistsUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseHubSpotKlaviyoCustomer.ioGoogle Analytics 4Looker StudioAhrefsSemrushCRM platforms

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowancePerformance BonusesConference Attendance SupportMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/ca/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/ca/affiliate-program-manager.md)[AI Content Editor →](https://jobicy.com/salaries/ca/ai-content-editor.md)[Brand Content Strategist →](https://jobicy.com/salaries/ca/brand-content-strategist.md)[Brand Strategist →](https://jobicy.com/salaries/ca/brand-strategist.md)[Content Designer →](https://jobicy.com/salaries/ca/content-designer.md)[Content Optimization Lead →](https://jobicy.com/salaries/ca/content-optimization-lead.md)[Content Quality Manager →](https://jobicy.com/salaries/ca/content-quality-manager.md)[Content Strategist →](https://jobicy.com/salaries/ca/content-strategist.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/ca/conversion-optimization-manager.md)[Conversion Rate Specialist →](https://jobicy.com/salaries/ca/conversion-rate-specialist.md)[Copywriter →](https://jobicy.com/salaries/ca/copywriter.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/ca/customer-acquisition-manager.md)[Digital Campaign Manager →](https://jobicy.com/salaries/ca/digital-campaign-manager.md)[Digital Marketing Manager →](https://jobicy.com/salaries/ca/digital-marketing-manager.md)[Digital Marketing Strategist →](https://jobicy.com/salaries/ca/digital-marketing-strategist.md)Market intelligence

## Hiring context for Email Marketing Strategist in Canada.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Very High

Current hiring-demand signal for this role across the tracked market.

Growth

### 25% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Very High

Focus on digital well-being and work-life balance initiatives specific to remote work environments

###

Key industries

Software as a ServiceE-commerceMedia and PublishingConsumer ProductsFinTechDigital AgenciesCross-country pay scale

## Compare Email Marketing Strategist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$59,80021% lower](https://jobicy.com/salaries/ae/email-marketing-strategist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$46,40039% lower](https://jobicy.com/salaries/at/email-marketing-strategist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$77,4002% higher](https://jobicy.com/salaries/au/email-marketing-strategist.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$51,20032% lower](https://jobicy.com/salaries/be/email-marketing-strategist.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$95,50026% higher](https://jobicy.com/salaries/ch/email-marketing-strategist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$61,80018% lower](https://jobicy.com/salaries/de/email-marketing-strategist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$35,40053% lower](https://jobicy.com/salaries/es/email-marketing-strategist.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$48,30036% lower](https://jobicy.com/salaries/fr/email-marketing-strategist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Email Marketing Strategist salary in Canada?

The estimated average annual salary is $75,600. Junior roles are estimated at $46,700–$59,800, while senior roles are estimated at $91,200–$135,700.

What is the hourly rate for this role?

The estimated hourly equivalent is between $23.63 and $56.34 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Deliverability, Lifecycle journeys, Segmentation, Email experimentation, Audience research. Trending and emerging requirements include Lifecycle marketing, First-party data strategy, Marketing automation, Incrementality testing, AI-assisted content operations.

What is the market outlook?

Jobicy currently classifies demand as Very High, with a growth signal of 25% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Email Marketing Strategist in Canada, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Canada and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Email Marketing Strategist in Canada, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Email%20Marketing%20Strategist.md)[Salary API](https://jobicy.com/salary-api.md)