[Salaries in Switzerland](https://jobicy.com/salaries/ch.md)2026 Salary Report

# 3D Artist salary in Switzerland.

The 3D Artist role creates production-ready 3D models, materials, lighting, and rendered assets within visual and technical constraints. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarity. For Switzerland, this report combines salary benchmarks in CHF with modeled assumptions for a 20% tax rate, 20 days of annual leave, and a 115.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$97,300Estimated annual average$6,487Estimated monthly take-home$30.41–$72.51Hourly equivalent range30 Sep 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy3480 recent job listings and community reports shaped this estimateUpdated 30 Sep 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$97,300Annual benchmarkJunior$61,300–$79,1000-2 yearsMid-level$79,300–$118,9003-5 yearsSenior$120,800–$177,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$6,487Hourly equivalentBased on a standard 40-hour week$30.41–$72.51Potential annual bonusIllustrative 10–15% performance range$9,730–$14,595

### Planning reference

Monthly savings target33% illustrative allocation$2,700Retirement contribution11% illustrative allocation$900Housing budgetIllustrative 20% monthly ceilingUp to $1,600Emergency fundThree to six months of gross income$24,325–$48,650

### Healthcare infrastructure

Private-market healthcare estimateIllustrative annual allowance for medical, dental, and vision insurance in a private-tier employment or contractor market≈ $5,838/year
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to 3D Artist pay in Switzerland.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for 3D Artist in Switzerland](https://jobicy.com/api/jpgraph/chart.php?junior_min=61300&junior_max=79100&middle_min=79300&middle_max=118900&senior_min=120800&senior_max=177600&average=97300&currency=%24&currency_code=USD&title=3D%20Artist&country=Switzerland)
Salary ranges

Enlarge
![Salary progression by experience for 3D Artist in Switzerland](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=70200&m_avg=99100&s_avg=149200&currency=%24&currency_code=USD&title=3D%20Artist&country=Switzerland)
Experience growthEnlarge
![Illustrative monthly salary allocation for 3D Artist in Switzerland](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1622&savings=2651&retirement=868&housing=1622&disposable=1346&currency=%24&currency_code=USD&title=3D%20Artist&country=Switzerland)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.4% over the displayed period, moving from $96,000 to $97,300.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$97,300$30–$73Sep 2026$98,100$31–$73Aug 2026$98,800$31–$74Jul 2026$98,400$31–$73Jun 2026$95,300$30–$71May 2026$96,300$30–$72Apr 2026$97,500$30–$73Mar 2026$94,800$30–$71Feb 2026$94,600$30–$70Jan 2026$98,100$31–$73Dec 2025$94,500$30–$70Nov 2025$96,000$30–$72Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![NVE Experience Agency logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/ddc1676e-221.png) Associate Resource Director, CreativeNVE Experience Agency→](https://jobicy.com/jobs/154989-associate-resource-director-creative.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=3D%20Artist.md)Career profile

## Pay drivers and skills for 3D Artist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

3D modelingTexturingLightingRenderingVisual communicationDesign systems

### Education requirements

A degree in design, visual communication, interaction design, or an equivalent professional portfolioA portfolio that explains process, constraints, iteration, and measurable outcomes rather than only final visuals

### Training and development

Accessibility and inclusive design reviewsFacilitated critique sessionsDesign-system contribution workshopsResearch synthesis practiceAdvanced prototyping labs

### Core skills

3D modelingTexturingLightingRenderingVisual communicationDesign systemsPrototypingUser-centered designAccessibility

### Trending and emerging skills

Responsive systemsInclusive designDesign operationsMotion principlesAI-assisted creative workflowsSpatial interfacesGenerative design systemsMultimodal prototypingReal-time 3D experiences

### Key responsibilities

Own the planning and delivery of work in the 3D Artist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarityInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Portfolio quality and demonstrated outcomesProduct or brand complexityResearch and accessibility capabilityDesign-system ownershipAdvanced production-tool expertiseScope of creative direction and stakeholder influence

### Typical career path

Entry-level or associate role in the discipline3D ArtistSenior 3D ArtistLead designer, design systems leadership, creative direction, or design management

### Work specifics

Remote creative team using shared design systems, documented feedback, and frequent prototype reviewsWorks closely with research, product, engineering, content, marketing, and brand stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseBlenderMayaSubstance 3DUnreal EngineFigmaAdobe Creative CloudMiroNotion

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Animation Director →](https://jobicy.com/salaries/ch/animation-director.md)[AR/VR Designer →](https://jobicy.com/salaries/ch/ar-vr-designer.md)[Content Designer →](https://jobicy.com/salaries/ch/content-designer.md)[Creative Director →](https://jobicy.com/salaries/ch/creative-director.md)[Data Visualization Specialist →](https://jobicy.com/salaries/ch/data-visualization-specialist.md)[Digital Product Designer →](https://jobicy.com/salaries/ch/digital-product-designer.md)[Instructional Designer →](https://jobicy.com/salaries/ch/instructional-designer.md)[Learning Experience Designer →](https://jobicy.com/salaries/ch/learning-experience-designer.md)[Motion Designer →](https://jobicy.com/salaries/ch/motion-designer.md)[Multimedia Producer →](https://jobicy.com/salaries/ch/multimedia-producer.md)[Podcast Producer →](https://jobicy.com/salaries/ch/podcast-producer.md)[Service Design Manager →](https://jobicy.com/salaries/ch/service-design-manager.md)[Social Content Producer →](https://jobicy.com/salaries/ch/social-content-producer.md)[User Research Manager →](https://jobicy.com/salaries/ch/user-research-manager.md)[UX Designer →](https://jobicy.com/salaries/ch/ux-designer.md)[Video Editor →](https://jobicy.com/salaries/ch/video-editor.md)Market intelligence

## Hiring context for 3D Artist in Switzerland.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Growing adoption of hybrid work models allowing flexibility between office and remote work, with 2-3 days of remote work becoming standard

###

Key industries

Software as a ServiceE-commerceMedia and EntertainmentConsumer TechnologyGamingDigital AgenciesCross-country pay scale

## Compare 3D Artist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$59,90038% lower](https://jobicy.com/salaries/ae/3d-artist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$46,50052% lower](https://jobicy.com/salaries/at/3d-artist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$73,40025% lower](https://jobicy.com/salaries/au/3d-artist.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$50,80048% lower](https://jobicy.com/salaries/be/3d-artist.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$72,60025% lower](https://jobicy.com/salaries/ca/3d-artist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$61,30037% lower](https://jobicy.com/salaries/de/3d-artist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$35,40064% lower](https://jobicy.com/salaries/es/3d-artist.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$49,00050% lower](https://jobicy.com/salaries/fr/3d-artist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average 3D Artist salary in Switzerland?

The estimated average annual salary is $97,300. Junior roles are estimated at $61,300–$79,100, while senior roles are estimated at $120,800–$177,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $30.41 and $72.51 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include 3D modeling, Texturing, Lighting, Rendering, Visual communication. Trending and emerging requirements include Responsive systems, Inclusive design, Design operations, Motion principles, AI-assisted creative workflows.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for 3D Artist in Switzerland, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Switzerland and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for 3D Artist in Switzerland, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=3D%20Artist.md)[Salary API](https://jobicy.com/salary-api.md)