[Salaries in Switzerland](https://jobicy.com/salaries/ch.md)2026 Salary Report

# Site Reliability Engineer salary in Switzerland.

The average salary for Site Reliability Engineer in Switzerland is $161,300 per year, according to Jobicy salary data updated 10 Oct 2026. Entry-level positions start around $101,500–$126,600, while experienced professionals earn $201,000–$279,500.
Average compensation has increased 4.8% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 10 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$161,300Estimated annual average$10,753Estimated monthly take-home$50.41–$120.20Hourly equivalent range10 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Site Reliability Engineer role keeps production services reliable through automation, observability, capacity planning, and incident learning. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as reliability, delivery lead time, defect rate, maintainability, and user impact. For Switzerland, this report combines salary benchmarks in CHF with modeled assumptions for a 20% tax rate, 20 days of annual leave, and a 115.0 cost-of-living index relative to the United States baseline.

High accuracy2643 recent job listings and community reports shaped this estimateUpdated 10 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$161,300Annual benchmarkJunior$101,500–$126,6000-2 yearsMid-level$130,800–$195,5003-5 yearsSenior$201,000–$279,5006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$10,753Hourly equivalentBased on a standard 40-hour week$50.41–$120.20Potential annual bonusIllustrative 10–15% performance range$16,130–$24,195

### Planning reference

Monthly savings target33% illustrative allocation$4,400Retirement contribution15% illustrative allocation$2,000Housing budgetIllustrative 20% monthly ceilingUp to $2,700Emergency fundThree to six months of gross income$40,325–$80,650

### Healthcare infrastructure

Private-market healthcare estimateIllustrative annual allowance for medical, dental, and vision insurance in a private-tier employment or contractor market≈ $9,678/year
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Site Reliability Engineer pay in Switzerland.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Site Reliability Engineer in Switzerland](https://jobicy.com/api/jpgraph/chart.php?junior_min=101500&junior_max=126600&middle_min=130800&middle_max=195500&senior_min=201000&senior_max=279500&average=161300&currency=%24&currency_code=USD&title=Site%20Reliability%20Engineer&country=Switzerland)
Salary ranges

Enlarge
![Salary progression by experience for Site Reliability Engineer in Switzerland](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=114050&m_avg=163150&s_avg=240250&currency=%24&currency_code=USD&title=Site%20Reliability%20Engineer&country=Switzerland)
Experience growthEnlarge
![Illustrative monthly salary allocation for Site Reliability Engineer in Switzerland](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2688&savings=4449&retirement=2043&housing=2688&disposable=1573&currency=%24&currency_code=USD&title=Site%20Reliability%20Engineer&country=Switzerland)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.8% over the displayed period, moving from $153,900 to $161,300.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$161,300$50–$120Sep 2026$151,800$47–$113Aug 2026$155,600$49–$116Jul 2026$149,500$47–$111Jun 2026$155,300$49–$116May 2026$158,200$49–$118Apr 2026$155,200$49–$116Mar 2026$156,000$49–$116Feb 2026$149,800$47–$112Jan 2026$155,700$49–$116Dec 2025$145,300$45–$108Nov 2025$153,900$48–$115Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Apaleo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/6d684c9f-221.png) Senior Backend Engineer, PlatformApaleo→](https://jobicy.com/jobs/155450-senior-backend-engineer-platform.md) [![Supabase logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/611d3bfa-221.png) Multigres Deployment EngineerSupabase→](https://jobicy.com/jobs/153326-multigres-deployment-engineer.md) [![Close logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/09/Closeio.png) Senior Product Security Engineer (USA Only, 100% Remote)Close→](https://jobicy.com/jobs/155398-senior-product-security-engineer-usa-only-100-remote.md) [![Supabase logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/611d3bfa-221.png) Site Reliability EngineerSupabase→](https://jobicy.com/jobs/155391-site-reliability-engineer-4.md) [![Supabase logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/611d3bfa-221.png) Platform Engineer, Managed PostgresSupabase→](https://jobicy.com/jobs/155389-platform-engineer-managed-postgres.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Site%20Reliability%20Engineer.md)Career profile

## Pay drivers and skills for Site Reliability Engineer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 4-7 years of directly relevant experience supported by evidence of independent, high-impact delivery

### Required skills

Service-level objectivesIncident managementDistributed systemsCapacity planningSoftware designData structures

### Education requirements

A degree in computer science, software engineering, or equivalent production experienceEvidence of building, testing, and maintaining software beyond tutorial projects

### Training and development

Incident response simulationsCloud deployment labsProduction architecture reviewsSecure development lifecycle workshopsPerformance profiling practice

### Core skills

Service-level objectivesIncident managementDistributed systemsCapacity planningSoftware designData structuresDebuggingTestingVersion control

### Trending and emerging skills

Secure codingAI-assisted developmentCloud-native developmentContinuous deliveryObservabilityPlatform engineeringSoftware supply-chain securityAgentic development workflowsEdge computing

### Key responsibilities

Own the planning and delivery of work in the Site Reliability Engineer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against reliability, delivery lead time, defect rate, maintainability, and user impactInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

System scale and technical complexityDepth in the primary programming stackCloud, security, and reliability ownershipArchitecture and technical decision scopeProduction incident responsibilityMentoring and cross-team influence

### Typical career path

Entry-level or associate role in the disciplineSite Reliability EngineerSenior Site Reliability EngineerStaff or principal engineering, architecture, or engineering management

### Work specifics

Remote engineering team working through reviewed code, automated tests, and documented technical decisionsWorks with product, design, quality, security, and infrastructure partners throughout deliveryUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseKubernetesPrometheusGrafanaPagerDutyGitGitHubDockerCI/CD

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/ch/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/ch/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/ch/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/ch/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/ch/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/ch/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/ch/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/ch/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/ch/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/ch/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/ch/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/ch/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/ch/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/ch/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/ch/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/ch/devops-engineer.md)Market intelligence

## Hiring context for Site Reliability Engineer in Switzerland.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Focus on digital well-being and work-life balance initiatives specific to remote work environments

###

Key industries

Software as a ServiceCloud ComputingFinTechE-commerceCybersecurityDeveloper ToolsCross-country pay scale

## Compare Site Reliability Engineer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$92,00043% lower](https://jobicy.com/salaries/ae/site-reliability-engineer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$72,70055% lower](https://jobicy.com/salaries/at/site-reliability-engineer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$118,20027% lower](https://jobicy.com/salaries/au/site-reliability-engineer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$81,70049% lower](https://jobicy.com/salaries/be/site-reliability-engineer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$114,70029% lower](https://jobicy.com/salaries/ca/site-reliability-engineer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$100,40038% lower](https://jobicy.com/salaries/de/site-reliability-engineer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$56,40065% lower](https://jobicy.com/salaries/es/site-reliability-engineer.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$72,80055% lower](https://jobicy.com/salaries/fr/site-reliability-engineer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Site Reliability Engineer salary in Switzerland?

The estimated average annual salary is $161,300. Junior roles are estimated at $101,500–$126,600, while senior roles are estimated at $201,000–$279,500.

What is the hourly rate for this role?

The estimated hourly equivalent is between $50.41 and $120.20 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Service-level objectives, Incident management, Distributed systems, Capacity planning, Software design. Trending and emerging requirements include Secure coding, AI-assisted development, Cloud-native development, Continuous delivery, Observability.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Site Reliability Engineer in Switzerland, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Switzerland and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Site Reliability Engineer in Switzerland, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Site%20Reliability%20Engineer.md)[Salary API](https://jobicy.com/salary-api.md)