[Salaries in Germany](https://jobicy.com/salaries/de.md)2026 Salary Report

# Fintech Product Manager salary in Germany.

The average salary for Fintech Product Manager in Germany is $92,500 per year, according to Jobicy salary data updated 12 Oct 2026. Entry-level positions start around $55,700–$72,400, while experienced professionals earn $113,700–$165,700.
Average compensation has increased 2.8% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 12 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$92,500Estimated annual average$4,471Estimated monthly take-home$28.91–$68.93Hourly equivalent range12 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The core purpose of a Fintech Product Manager is practical: the professional develops financial products that balance customer value, regulation, risk, economics, and reliable delivery. Day-to-day priorities vary by company, but performance is generally visible in forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For Germany, this report combines salary benchmarks in EUR with modeled assumptions for a 42% tax rate, 20 days of annual leave, and a 76.0 cost-of-living index relative to the United States baseline.

High accuracy983 recent job listings and community reports shaped this estimateUpdated 12 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$92,500Annual benchmarkJunior$55,700–$72,4000-2 yearsMid-level$75,000–$109,3003-5 yearsSenior$113,700–$165,7006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 42% tax rate$4,471Hourly equivalentBased on a standard 40-hour week$28.91–$68.93Potential annual bonusIllustrative 10–15% performance range$9,250–$13,875

### Planning reference

Monthly savings target29% illustrative allocation$2,200Retirement contribution12% illustrative allocation$1,000Housing budgetIllustrative 20% monthly ceilingUp to $1,500Emergency fundThree to six months of gross income$23,125–$46,250

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 42% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Fintech Product Manager pay in Germany.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Fintech Product Manager in Germany](https://jobicy.com/api/jpgraph/chart.php?junior_min=55700&junior_max=72400&middle_min=75000&middle_max=109300&senior_min=113700&senior_max=165700&average=92500&currency=%24&currency_code=USD&title=Fintech%20Product%20Manager&country=Germany)
Salary ranges

Enlarge
![Salary progression by experience for Fintech Product Manager in Germany](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=64050&m_avg=92150&s_avg=139700&currency=%24&currency_code=USD&title=Fintech%20Product%20Manager&country=Germany)
Experience growthEnlarge
![Illustrative monthly salary allocation for Fintech Product Manager in Germany](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=3238&savings=2212&retirement=956&housing=1542&disposable=0&currency=%24&currency_code=USD&title=Fintech%20Product%20Manager&country=Germany)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2.8% over the displayed period, moving from $90,000 to $92,500.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$92,500$29–$69Sep 2026$93,200$29–$69Aug 2026$96,700$30–$72Jul 2026$95,300$30–$71Jun 2026$94,600$30–$70May 2026$98,200$31–$73Apr 2026$95,600$30–$71Mar 2026$93,100$29–$69Feb 2026$90,300$28–$67Jan 2026$93,800$29–$70Dec 2025$94,500$30–$70Nov 2025$90,000$28–$67Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Moss logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/eb32a809-221.png) Senior Product Manager (m/f/d)Moss→](https://jobicy.com/jobs/155610-senior-product-manager-m-f-d.md) [![HackerOne logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/8937d355-221.png) Senior Manager, AI EngineeringHackerOne→](https://jobicy.com/jobs/153461-senior-manager-ai-engineering-2.md) [![Fieldguide logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/afa73463-221.png) Senior Performance Marketing ManagerFieldguide→](https://jobicy.com/jobs/153411-senior-performance-marketing-manager-2.md) [![Goodleap logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/482c4fb7-221.png) Engineering Manager, AI TransformationGoodleap→](https://jobicy.com/jobs/153397-engineering-manager-ai-transformation.md) [![Workleap logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b84329e1-221.png) Marketing Analyst, Attribution - ShareGateWorkleap→](https://jobicy.com/jobs/155516-marketing-analyst-attribution-sharegate.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Fintech%20Product%20Manager.md)Career profile

## Pay drivers and skills for Fintech Product Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Product discoveryRoadmappingOutcome metricsPrioritizationFinancial analysisForecasting

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Control and compliance refreshersScenario-planning workshopsData visualization trainingAutomation and systems labsFinancial modeling practice

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Product discoveryRoadmappingOutcome metricsPrioritizationFinancial analysisForecastingReconciliationFinancial modelingControls

### Trending and emerging skills

Continuous planningFinance automationScenario modelingReal-time reportingIntegrated business planningAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Fintech Product Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipFinancial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposure

### Typical career path

Senior individual contributor or team leadFintech Product ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseProductboardAmplitudeFigmaExcelGoogle SheetsERP systemsPower BISQL

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceCompulsory Health Insurance IntegrationExtended Paid Parental LeaveMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/de/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/de/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/de/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/de/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/de/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/de/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/de/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/de/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/de/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/de/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/de/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/de/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/de/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/de/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/de/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/de/customer-success-director.md)Market intelligence

## Hiring context for Fintech Product Manager in Germany.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Adoption of sophisticated project management tools and productivity tracking systems for remote teams

###

Key industries

FinTechBankingPaymentsFinancial ServicesCross-country pay scale

## Compare Fintech Product Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$92,9000% higher](https://jobicy.com/salaries/ae/fintech-product-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$70,00024% lower](https://jobicy.com/salaries/at/fintech-product-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$117,90027% higher](https://jobicy.com/salaries/au/fintech-product-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$78,60015% lower](https://jobicy.com/salaries/be/fintech-product-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$113,60023% higher](https://jobicy.com/salaries/ca/fintech-product-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$149,60062% higher](https://jobicy.com/salaries/ch/fintech-product-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$57,40038% lower](https://jobicy.com/salaries/es/fintech-product-manager.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$70,80023% lower](https://jobicy.com/salaries/fr/fintech-product-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Fintech Product Manager salary in Germany?

The estimated average annual salary is $92,500. Junior roles are estimated at $55,700–$72,400, while senior roles are estimated at $113,700–$165,700.

What is the hourly rate for this role?

The estimated hourly equivalent is between $28.91 and $68.93 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Product discovery, Roadmapping, Outcome metrics, Prioritization, Financial analysis. Trending and emerging requirements include Continuous planning, Finance automation, Scenario modeling, Real-time reporting, Integrated business planning.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Fintech Product Manager in Germany, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Germany and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Fintech Product Manager in Germany, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Fintech%20Product%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)