[Salaries in Spain](https://jobicy.com/salaries/es.md)2026 Salary Report

# Employee Experience Manager salary in Spain.

The average salary for Employee Experience Manager in Spain is $40,100 per year, according to Jobicy salary data updated 9 Oct 2026. Entry-level positions start around $25,200–$31,200, while experienced professionals earn $47,000–$74,600.
Average compensation has increased 4.7% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 9 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$40,100Estimated annual average$2,105Estimated monthly take-home$12.53–$29.88Hourly equivalent range9 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

An Employee Experience Manager improves the employee journey by combining listening data, service design, communications, and program delivery. The work combines subject-matter judgment with disciplined execution and is commonly assessed through retention, engagement, hiring quality, workforce readiness, service quality, and program fairness. For Spain, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 60.0 cost-of-living index relative to the United States baseline.

Reliable accuracy278 recent job listings and community reports shaped this estimateUpdated 9 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$40,100Annual benchmarkJunior$25,200–$31,2000-2 yearsMid-level$32,200–$48,9003-5 yearsSenior$47,000–$74,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$2,105Hourly equivalentBased on a standard 40-hour week$12.53–$29.88Potential annual bonusIllustrative 10–15% performance range$4,010–$6,015

### Planning reference

Monthly savings target21% illustrative allocation$700Retirement contribution12% illustrative allocation$400Housing budgetIllustrative 20% monthly ceilingUp to $700Emergency fundThree to six months of gross income$10,025–$20,050

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Employee Experience Manager pay in Spain.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Employee Experience Manager in Spain](https://jobicy.com/api/jpgraph/chart.php?junior_min=25200&junior_max=31200&middle_min=32200&middle_max=48900&senior_min=47000&senior_max=74600&average=40100&currency=%24&currency_code=USD&title=Employee%20Experience%20Manager&country=Spain)
Salary ranges

Enlarge
![Salary progression by experience for Employee Experience Manager in Spain](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=28200&m_avg=40550&s_avg=60800&currency=%24&currency_code=USD&title=Employee%20Experience%20Manager&country=Spain)
Experience growthEnlarge
![Illustrative monthly salary allocation for Employee Experience Manager in Spain](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1236&savings=712&retirement=414&housing=668&disposable=311&currency=%24&currency_code=USD&title=Employee%20Experience%20Manager&country=Spain)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.7% over the displayed period, moving from $38,300 to $40,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$40,100$13–$30Sep 2026$37,800$12–$28Aug 2026$39,000$12–$29Jul 2026$37,500$12–$28Jun 2026$38,200$12–$28May 2026$38,200$12–$28Apr 2026$38,300$12–$29Mar 2026$38,100$12–$28Feb 2026$36,700$11–$27Jan 2026$37,200$12–$28Dec 2025$36,500$11–$27Nov 2025$38,300$12–$29Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Wheel logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/01/WRILS-210112005722-210970.jpg) Marketplace Operations Manager IIWheel→](https://jobicy.com/jobs/153335-marketplace-operations-manager-ii.md) [![TE Connectivity logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/07/44e3e9132b6f-221.webp) ANALYST DIGITAL MARKETING IV (Remote) IVTE Connectivity→](https://jobicy.com/jobs/150674-analyst-digital-marketing-iv-remote-iv.md) [![TE Connectivity logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/07/44e3e9132b6f-221.webp) Account Manager IV (Remote in Bay Area, CA)TE Connectivity→](https://jobicy.com/jobs/150672-account-manager-iv-remote-in-bay-area-ca.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Sales Engineer, EnterpriseSocket→](https://jobicy.com/jobs/153337-sales-engineer-enterprise-2.md) [![Quantum Metric logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/52363ead-221.jpg) Solutions Engineer - USQuantum Metric→](https://jobicy.com/jobs/153333-solutions-engineer-us.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Employee%20Experience%20Manager.md)Career profile

## Pay drivers and skills for Employee Experience Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Employee relationsTalent practicesPolicy designCoachingWorkforce planningPeople analytics

### Education requirements

A degree in human resources, organizational psychology, business, or equivalent people-operations experienceWorking knowledge of fair employment practices, confidential data handling, and evidence-based people programs

### Training and development

People analytics labsInclusive program designEmployment-practice updatesStructured interviewing workshopsCoaching and feedback practice

### Professional certifications

SHRM, CIPD, or equivalent when relevant

### Core skills

Employee relationsTalent practicesPolicy designCoachingWorkforce planningPeople analyticsChange communicationConfidentiality

### Trending and emerging skills

Inclusive talent systemsSkills-based organizationsEmployee listeningDistributed work designPeople analyticsAI governance in HRInternal talent marketplacesDynamic workforce planningPersonalized learning systems

### Key responsibilities

Own the planning and delivery of work in the Employee Experience Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against retention, engagement, hiring quality, workforce readiness, service quality, and program fairnessInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipWorkforce size and geographic complexityEmployee-relations and compliance exposureProgram or organization-wide ownershipPeople analytics and systems capabilityLeadership advisory responsibility

### Typical career path

Senior individual contributor or team leadEmployee Experience ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote people team handling confidential information through consistent policies, documented processes, and employee-centered serviceAdvises employees, managers, executives, finance, legal, recruiting, and learning partnersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseHRISApplicant tracking systemsSurvey platformsLearning platformsSpreadsheetsNotionVideo conferencing

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/es/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/es/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/es/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/es/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/es/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/es/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/es/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/es/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/es/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/es/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/es/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/es/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/es/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/es/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/es/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/es/customer-success-director.md)Market intelligence

## Hiring context for Employee Experience Manager in Spain.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Investment in high-quality home office equipment and ergonomic workspace solutions for remote employees

###

Key industries

Human Resources TechnologySoftware as a ServiceProfessional ServicesHealthcareFinancial ServicesE-commerceCross-country pay scale

## Compare Employee Experience Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$65,10062% higher](https://jobicy.com/salaries/ae/employee-experience-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$48,30020% higher](https://jobicy.com/salaries/at/employee-experience-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$81,300103% higher](https://jobicy.com/salaries/au/employee-experience-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$56,20040% higher](https://jobicy.com/salaries/be/employee-experience-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$74,80087% higher](https://jobicy.com/salaries/ca/employee-experience-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$107,300168% higher](https://jobicy.com/salaries/ch/employee-experience-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$67,90069% higher](https://jobicy.com/salaries/de/employee-experience-manager.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$50,30025% higher](https://jobicy.com/salaries/fr/employee-experience-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Employee Experience Manager salary in Spain?

The estimated average annual salary is $40,100. Junior roles are estimated at $25,200–$31,200, while senior roles are estimated at $47,000–$74,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $12.53 and $29.88 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Employee relations, Talent practices, Policy design, Coaching, Workforce planning. Trending and emerging requirements include Inclusive talent systems, Skills-based organizations, Employee listening, Distributed work design, People analytics.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Employee Experience Manager in Spain, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Spain and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Employee Experience Manager in Spain, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Employee%20Experience%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)