[Salaries in Spain](https://jobicy.com/salaries/es.md)2026 Salary Report

# Financial Analyst salary in Spain.

The Financial Analyst role evaluates financial performance, drivers, scenarios, and investment choices through structured analysis. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For Spain, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 60.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$37,300Estimated annual average$1,958Estimated monthly take-home$11.66–$27.80Hourly equivalent range5 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy285 recent job listings and community reports shaped this estimateUpdated 5 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$37,300Annual benchmarkJunior$22,400–$29,4000-2 yearsMid-level$29,400–$44,1003-5 yearsSenior$46,500–$68,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$1,958Hourly equivalentBased on a standard 40-hour week$11.66–$27.80Potential annual bonusIllustrative 10–15% performance range$3,730–$5,595

### Planning reference

Monthly savings target23% illustrative allocation$700Retirement contribution13% illustrative allocation$400Housing budgetIllustrative 20% monthly ceilingUp to $600Emergency fundThree to six months of gross income$9,325–$18,650

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Financial Analyst pay in Spain.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Financial Analyst in Spain](https://jobicy.com/api/jpgraph/chart.php?junior_min=22400&junior_max=29400&middle_min=29400&middle_max=44100&senior_min=46500&senior_max=68600&average=37300&currency=%24&currency_code=USD&title=Financial%20Analyst&country=Spain)
Salary ranges

Enlarge
![Salary progression by experience for Financial Analyst in Spain](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=25900&m_avg=36750&s_avg=57550&currency=%24&currency_code=USD&title=Financial%20Analyst&country=Spain)
Experience growthEnlarge
![Illustrative monthly salary allocation for Financial Analyst in Spain](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1150&savings=718&retirement=392&housing=622&disposable=227&currency=%24&currency_code=USD&title=Financial%20Analyst&country=Spain)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.1% over the displayed period, moving from $36,900 to $37,300.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$37,300$12–$28Sep 2026$39,200$12–$29Aug 2026$38,500$12–$29Jul 2026$38,000$12–$28Jun 2026$37,300$12–$28May 2026$39,300$12–$29Apr 2026$38,600$12–$29Mar 2026$38,600$12–$29Feb 2026$39,000$12–$29Jan 2026$38,000$12–$28Dec 2025$38,300$12–$29Nov 2025$36,900$12–$27Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Monks logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/d832a699-221.jpeg) Performance Media AnalystMonks→](https://jobicy.com/jobs/152913-performance-media-analyst.md) [![Kalshi logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/00635b6c-221.png) Operations Risk AnalystKalshi→](https://jobicy.com/jobs/152900-operations-risk-analyst.md) [![Jobber logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/135a74b7-221.jpeg) Manager, Credit RiskJobber→](https://jobicy.com/jobs/154930-manager-credit-risk.md) [![hims & hers logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2023/11/e7b9b920-221.jpeg) Financial Analyst, FP&Ahims & hers→](https://jobicy.com/jobs/154913-financial-analyst-fpa-2.md) [![Samsara logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/dd26f5ca-221.jpg) Deal Desk AnalystSamsara→](https://jobicy.com/jobs/154902-deal-desk-analyst-6.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Analyst.md)Career profile

## Pay drivers and skills for Financial Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliation

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Control and compliance refreshersScenario-planning workshopsData visualization trainingAutomation and systems labsFinancial modeling practice

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliationControlsReportingBusiness partnering

### Trending and emerging skills

Finance automationScenario modelingReal-time reportingIntegrated business planningContinuous planningAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Financial Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Financial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposureInfluence on capital and operating decisions

### Typical career path

Entry-level or associate role in the disciplineFinancial AnalystSenior Financial AnalystSenior analyst, finance manager, controllership, treasury, or finance leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseExcelGoogle SheetsERP systemsPower BISQLPlanning softwareReconciliation tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Financial Data Analyst →](https://jobicy.com/salaries/es/financial-data-analyst.md)[Financial Planning Analyst →](https://jobicy.com/salaries/es/financial-planning-analyst.md)[Financial Reporting Manager →](https://jobicy.com/salaries/es/financial-reporting-manager.md)[Financial Systems Manager →](https://jobicy.com/salaries/es/financial-systems-manager.md)[Fintech Product Manager →](https://jobicy.com/salaries/es/fintech-product-manager.md)[Investment Operations Manager →](https://jobicy.com/salaries/es/investment-operations-manager.md)[Payment Systems Analyst →](https://jobicy.com/salaries/es/payment-systems-analyst.md)[Token Economist →](https://jobicy.com/salaries/es/token-economist.md)Market intelligence

## Hiring context for Financial Analyst in Spain.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Adoption of sophisticated project management tools and productivity tracking systems for remote teams

###

Key industries

Financial ServicesFinTechBankingInvestment ManagementSoftware as a ServiceE-commerceCross-country pay scale

## Compare Financial Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$64,00072% higher](https://jobicy.com/salaries/ae/financial-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$48,40030% higher](https://jobicy.com/salaries/at/financial-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$78,400110% higher](https://jobicy.com/salaries/au/financial-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$54,70047% higher](https://jobicy.com/salaries/be/financial-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$74,800101% higher](https://jobicy.com/salaries/ca/financial-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$100,100168% higher](https://jobicy.com/salaries/ch/financial-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$65,40075% higher](https://jobicy.com/salaries/de/financial-analyst.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$51,30038% higher](https://jobicy.com/salaries/fr/financial-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Financial Analyst salary in Spain?

The estimated average annual salary is $37,300. Junior roles are estimated at $22,400–$29,400, while senior roles are estimated at $46,500–$68,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $11.66 and $27.80 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Financial modeling, Forecasting, Variance analysis, Management reporting, Financial analysis. Trending and emerging requirements include Finance automation, Scenario modeling, Real-time reporting, Integrated business planning, Continuous planning.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Financial Analyst in Spain, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Spain and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Financial Analyst in Spain, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)