[Salaries in Spain](https://jobicy.com/salaries/es.md)2026 Salary Report

# HR Business Partner salary in Spain.

The average salary for HR Business Partner in Spain is $44,200 per year, according to Jobicy salary data updated 7 Oct 2026. Entry-level positions start around $26,700–$35,800, while experienced professionals earn $53,700–$82,500.
Average compensation has increased 3.5% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 7 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$44,200Estimated annual average$2,321Estimated monthly take-home$13.81–$32.94Hourly equivalent range7 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The HR Business Partner role advises leaders on organization design, talent, performance, change, and employee relations. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include retention, engagement, hiring quality, workforce readiness, service quality, and program fairness. For Spain, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 60.0 cost-of-living index relative to the United States baseline.

Reliable accuracy385 recent job listings and community reports shaped this estimateUpdated 7 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$44,200Annual benchmarkJunior$26,700–$35,8000-2 yearsMid-level$36,200–$53,1003-5 yearsSenior$53,700–$82,5006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$2,321Hourly equivalentBased on a standard 40-hour week$13.81–$32.94Potential annual bonusIllustrative 10–15% performance range$4,420–$6,630

### Planning reference

Monthly savings target23% illustrative allocation$800Retirement contribution16% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $700Emergency fundThree to six months of gross income$11,050–$22,100

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to HR Business Partner pay in Spain.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for HR Business Partner in Spain](https://jobicy.com/api/jpgraph/chart.php?junior_min=26700&junior_max=35800&middle_min=36200&middle_max=53100&senior_min=53700&senior_max=82500&average=44200&currency=%24&currency_code=USD&title=HR%20Business%20Partner&country=Spain)
Salary ranges

Enlarge
![Salary progression by experience for HR Business Partner in Spain](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=31250&m_avg=44650&s_avg=68100&currency=%24&currency_code=USD&title=HR%20Business%20Partner&country=Spain)
Experience growthEnlarge
![Illustrative monthly salary allocation for HR Business Partner in Spain](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1363&savings=829&retirement=600&housing=737&disposable=155&currency=%24&currency_code=USD&title=HR%20Business%20Partner&country=Spain)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3.5% over the displayed period, moving from $42,700 to $44,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$44,200$14–$33Sep 2026$43,900$14–$33Aug 2026$42,800$13–$32Jul 2026$44,100$14–$33Jun 2026$44,000$14–$33May 2026$43,300$14–$32Apr 2026$41,900$13–$31Mar 2026$41,200$13–$31Feb 2026$42,600$13–$32Jan 2026$42,300$13–$32Dec 2025$40,900$13–$30Nov 2025$42,700$13–$32Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![ClassDojo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/656b6a00-221.png) Monetization Growth Product ManagerClassDojo→](https://jobicy.com/jobs/155530-monetization-growth-product-manager.md) [![Dandy logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/2321b7db-221-1.jpeg) Senior Manager, Customer ExpansionDandy→](https://jobicy.com/jobs/155529-senior-manager-customer-expansion.md) [![ClassDojo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/656b6a00-221.png) Revenue Product LeadClassDojo→](https://jobicy.com/jobs/155525-revenue-product-lead.md) [![Juniper Square logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/90c359a8bed816e81ea39fa33a8314f3.png) Customer Success Manager, Mid-MarketJuniper Square→](https://jobicy.com/jobs/155522-customer-success-manager-mid-market-2.md) [![Juniper Square logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/90c359a8bed816e81ea39fa33a8314f3.png) Technical ConsultantJuniper Square→](https://jobicy.com/jobs/155526-technical-consultant-2.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=HR%20Business%20Partner.md)Career profile

## Pay drivers and skills for HR Business Partner.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Employee relationsTalent practicesPolicy designCoachingWorkforce planningPeople analytics

### Education requirements

A degree in human resources, organizational psychology, business, or equivalent people-operations experienceWorking knowledge of fair employment practices, confidential data handling, and evidence-based people programs

### Training and development

People analytics labsInclusive program designEmployment-practice updatesStructured interviewing workshopsCoaching and feedback practice

### Professional certifications

SHRM, CIPD, or equivalent when relevant

### Core skills

Employee relationsTalent practicesPolicy designCoachingWorkforce planningPeople analyticsChange communicationConfidentiality

### Trending and emerging skills

Employee listeningDistributed work designPeople analyticsInclusive talent systemsSkills-based organizationsAI governance in HRInternal talent marketplacesDynamic workforce planningPersonalized learning systems

### Key responsibilities

Own the planning and delivery of work in the HR Business Partner remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against retention, engagement, hiring quality, workforce readiness, service quality, and program fairnessCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Workforce size and geographic complexityEmployee-relations and compliance exposureProgram or organization-wide ownershipPeople analytics and systems capabilityLeadership advisory responsibilityHiring, rewards, or development specialization

### Typical career path

Entry-level or associate role in the disciplineHR Business PartnerSenior HR Business PartnerSenior people specialist, HR business partnership, people management, or functional leadership

### Work specifics

Remote people team handling confidential information through consistent policies, documented processes, and employee-centered serviceAdvises employees, managers, executives, finance, legal, recruiting, and learning partnersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseHRISApplicant tracking systemsSurvey platformsLearning platformsSpreadsheetsNotionVideo conferencing

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/es/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/es/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/es/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/es/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/es/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/es/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/es/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/es/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/es/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/es/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/es/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/es/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/es/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/es/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/es/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/es/customer-success-director.md)Market intelligence

## Hiring context for HR Business Partner in Spain.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Development of remote-specific career progression paths and virtual mentorship programs

###

Key industries

Human Resources TechnologySoftware as a ServiceProfessional ServicesHealthcareFinancial ServicesE-commerceCross-country pay scale

## Compare HR Business Partner pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$72,40064% higher](https://jobicy.com/salaries/ae/hr-business-partner.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$51,10016% higher](https://jobicy.com/salaries/at/hr-business-partner.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$91,200106% higher](https://jobicy.com/salaries/au/hr-business-partner.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$59,80035% higher](https://jobicy.com/salaries/be/hr-business-partner.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$86,80096% higher](https://jobicy.com/salaries/ca/hr-business-partner.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$112,800155% higher](https://jobicy.com/salaries/ch/hr-business-partner.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$76,90074% higher](https://jobicy.com/salaries/de/hr-business-partner.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$54,40023% higher](https://jobicy.com/salaries/fr/hr-business-partner.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average HR Business Partner salary in Spain?

The estimated average annual salary is $44,200. Junior roles are estimated at $26,700–$35,800, while senior roles are estimated at $53,700–$82,500.

What is the hourly rate for this role?

The estimated hourly equivalent is between $13.81 and $32.94 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Employee relations, Talent practices, Policy design, Coaching, Workforce planning. Trending and emerging requirements include Employee listening, Distributed work design, People analytics, Inclusive talent systems, Skills-based organizations.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for HR Business Partner in Spain, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Spain and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for HR Business Partner in Spain, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=HR%20Business%20Partner.md)[Salary API](https://jobicy.com/salary-api.md)