[Salaries in Spain](https://jobicy.com/salaries/es.md)2026 Salary Report

# Support Knowledge Manager salary in Spain.

The average salary for Support Knowledge Manager in Spain is $36,800 per year, according to Jobicy salary data updated 8 Oct 2026. Entry-level positions start around $22,800–$28,400, while experienced professionals earn $44,100–$63,800.
Average compensation has increased 8.2% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 8 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$36,800Estimated annual average$1,932Estimated monthly take-home$11.50–$27.42Hourly equivalent range8 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

A successful Support Knowledge Manager builds the knowledge system that helps customers and support teams find accurate, maintainable answers. Rather than measuring activity alone, organizations usually evaluate the role through resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuse. For Spain, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 60.0 cost-of-living index relative to the United States baseline.

Reliable accuracy214 recent job listings and community reports shaped this estimateUpdated 8 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$36,800Annual benchmarkJunior$22,800–$28,4000-2 yearsMid-level$29,500–$45,2003-5 yearsSenior$44,100–$63,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$1,932Hourly equivalentBased on a standard 40-hour week$11.50–$27.42Potential annual bonusIllustrative 10–15% performance range$3,680–$5,520

### Planning reference

Monthly savings target23% illustrative allocation$700Retirement contribution13% illustrative allocation$400Housing budgetIllustrative 20% monthly ceilingUp to $600Emergency fundThree to six months of gross income$9,200–$18,400

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Support Knowledge Manager pay in Spain.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Support Knowledge Manager in Spain](https://jobicy.com/api/jpgraph/chart.php?junior_min=22800&junior_max=28400&middle_min=29500&middle_max=45200&senior_min=44100&senior_max=63800&average=36800&currency=%24&currency_code=USD&title=Support%20Knowledge%20Manager&country=Spain)
Salary ranges

Enlarge
![Salary progression by experience for Support Knowledge Manager in Spain](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=25600&m_avg=37350&s_avg=53950&currency=%24&currency_code=USD&title=Support%20Knowledge%20Manager&country=Spain)
Experience growthEnlarge
![Illustrative monthly salary allocation for Support Knowledge Manager in Spain](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1135&savings=718&retirement=389&housing=613&disposable=212&currency=%24&currency_code=USD&title=Support%20Knowledge%20Manager&country=Spain)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 8.2% over the displayed period, moving from $34,000 to $36,800.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$36,800$12–$27Sep 2026$35,200$11–$26Aug 2026$34,900$11–$26Jul 2026$36,500$11–$27Jun 2026$36,900$12–$27May 2026$37,200$12–$28Apr 2026$36,100$11–$27Mar 2026$36,200$11–$27Feb 2026$35,000$11–$26Jan 2026$35,100$11–$26Dec 2025$36,400$11–$27Nov 2025$34,000$11–$25Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![TE Connectivity logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/07/44e3e9132b6f-221.webp) Account Manager IV (Remote in Bay Area, CA)TE Connectivity→](https://jobicy.com/jobs/150672-account-manager-iv-remote-in-bay-area-ca.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Sales Engineer, EnterpriseSocket→](https://jobicy.com/jobs/153337-sales-engineer-enterprise-2.md) [![Side logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/2176fda1-221.jpeg) Partner Success Manager - In Market, Southern CASide→](https://jobicy.com/jobs/150807-partner-success-manager-in-market-southern-ca.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Sales Engineer, CommercialSocket→](https://jobicy.com/jobs/153342-sales-engineer-commercial.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Forward Deployed Engineer, PythonSocket→](https://jobicy.com/jobs/153341-forward-deployed-engineer-python.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Support%20Knowledge%20Manager.md)Career profile

## Pay drivers and skills for Support Knowledge Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Technical troubleshootingCase ownershipEscalation managementKnowledge writingCustomer communicationTroubleshooting

### Education requirements

Relevant higher education or equivalent customer-facing and domain-specific experienceEvidence of clear written communication, structured troubleshooting, sound judgment, and empathetic service

### Training and development

Accessibility and inclusive service trainingKnowledge-base writing workshopsProduct troubleshooting labsDe-escalation practiceQuality calibration sessions

### Core skills

Technical troubleshootingCase ownershipEscalation managementKnowledge writingCustomer communicationTroubleshootingCase managementDe-escalationKnowledge management

### Trending and emerging skills

Self-service designSupport operations analyticsOmnichannel supportAI-assisted serviceCustomer health scoringAgent-assist systemsPredictive case routingMultilingual automationProactive support

### Key responsibilities

Own the planning and delivery of work in the Support Knowledge Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuseInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipProduct and troubleshooting complexityCustomer segment and service-level responsibilityEscalation and incident ownershipMultilingual or specialized domain capabilityQuality and knowledge-management impact

### Typical career path

Senior individual contributor or team leadSupport Knowledge ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote customer team using documented escalation paths, shared knowledge, quality reviews, and service-level targetsWorks with customers, product, engineering, operations, sales, and success teams to resolve issues and prevent recurrenceFollows documented service coverage and escalation schedules, with live overlap during assigned customer-support hoursZendeskIntercomJira Service ManagementSlackNotionCRM platformsScreen sharingQuality dashboards

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/es/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/es/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/es/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/es/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/es/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/es/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/es/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/es/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/es/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/es/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/es/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/es/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/es/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/es/customer-acquisition-manager.md)[Customer Experience Analyst →](https://jobicy.com/salaries/es/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/es/customer-insights-manager.md)Market intelligence

## Hiring context for Support Knowledge Manager in Spain.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Implementation of advanced cybersecurity measures and data protection protocols for distributed teams

###

Key industries

Software as a ServiceE-commerceFinTechConsumer TechnologyHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Support Knowledge Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$58,20058% higher](https://jobicy.com/salaries/ae/support-knowledge-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$44,00020% higher](https://jobicy.com/salaries/at/support-knowledge-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$73,500100% higher](https://jobicy.com/salaries/au/support-knowledge-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$53,20045% higher](https://jobicy.com/salaries/be/support-knowledge-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$75,000104% higher](https://jobicy.com/salaries/ca/support-knowledge-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$97,200164% higher](https://jobicy.com/salaries/ch/support-knowledge-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$61,50067% higher](https://jobicy.com/salaries/de/support-knowledge-manager.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$48,20031% higher](https://jobicy.com/salaries/fr/support-knowledge-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Support Knowledge Manager salary in Spain?

The estimated average annual salary is $36,800. Junior roles are estimated at $22,800–$28,400, while senior roles are estimated at $44,100–$63,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $11.50 and $27.42 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Technical troubleshooting, Case ownership, Escalation management, Knowledge writing, Customer communication. Trending and emerging requirements include Self-service design, Support operations analytics, Omnichannel support, AI-assisted service, Customer health scoring.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Support Knowledge Manager in Spain, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Spain and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Support Knowledge Manager in Spain, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Support%20Knowledge%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)