[Salaries in Spain](https://jobicy.com/salaries/es.md)2026 Salary Report

# Technical Writer salary in Spain.

A Technical Writer turns complex systems into accurate, task-oriented documentation for users, developers, and internal teams. The work combines subject-matter judgment with disciplined execution and is commonly assessed through qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contribution. For Spain, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 60.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$36,600Estimated annual average$1,922Estimated monthly take-home$11.44–$27.27Hourly equivalent range28 Sep 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy151 recent job listings and community reports shaped this estimateUpdated 28 Sep 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$36,600Annual benchmarkJunior$21,300–$28,2000-2 yearsMid-level$28,500–$43,7003-5 yearsSenior$43,400–$68,0006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$1,922Hourly equivalentBased on a standard 40-hour week$11.44–$27.27Potential annual bonusIllustrative 10–15% performance range$3,660–$5,490

### Planning reference

Monthly savings target22% illustrative allocation$700Retirement contribution13% illustrative allocation$400Housing budgetIllustrative 20% monthly ceilingUp to $600Emergency fundThree to six months of gross income$9,150–$18,300

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Technical Writer pay in Spain.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Technical Writer in Spain](https://jobicy.com/api/jpgraph/chart.php?junior_min=21300&junior_max=28200&middle_min=28500&middle_max=43700&senior_min=43400&senior_max=68000&average=36600&currency=%24&currency_code=USD&title=Technical%20Writer&country=Spain)
Salary ranges

Enlarge
![Salary progression by experience for Technical Writer in Spain](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=24750&m_avg=36100&s_avg=55700&currency=%24&currency_code=USD&title=Technical%20Writer&country=Spain)
Experience growthEnlarge
![Illustrative monthly salary allocation for Technical Writer in Spain](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1129&savings=668&retirement=387&housing=610&disposable=256&currency=%24&currency_code=USD&title=Technical%20Writer&country=Spain)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 6.7% over the displayed period, moving from $34,300 to $36,600.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$36,600$11–$27Sep 2026$37,300$12–$28Aug 2026$35,900$11–$27Jul 2026$36,100$11–$27Jun 2026$35,400$11–$26May 2026$34,800$11–$26Apr 2026$35,600$11–$27Mar 2026$35,600$11–$27Feb 2026$36,800$12–$27Jan 2026$36,200$11–$27Dec 2025$34,700$11–$26Nov 2025$34,300$11–$26Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Tenable logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/01879e02-221.jpg) Director, Content MarketingTenable→](https://jobicy.com/jobs/152653-director-content-marketing.md) [![Stripe logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/10/WRILS-201011073943-272457.png) Credit Risk Analyst Commercial Underwriter, West CoastStripe→](https://jobicy.com/jobs/154733-credit-risk-analyst-commercial-underwriter-west-coast.md) [![Brain Co. logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/b2bdd014-221.png) Specialty Insurance Underwriter/Coverage Attorney/Consultant/Professional (Contract)Brain Co.→](https://jobicy.com/jobs/152609-specialty-insurance-underwriter-coverage-attorney-consultant-professional-contract.md) [![Algolia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201202014849-982609.jpg) Senior Partner Manager, APACAlgolia→](https://jobicy.com/jobs/154615-senior-partner-manager-apac.md) [![Worldly logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/2fe6d418-221.jpg) Product Marketing Manager, Supplier Network GrowthWorldly→](https://jobicy.com/jobs/152508-product-marketing-manager-supplier-network-growth.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Technical%20Writer.md)Career profile

## Pay drivers and skills for Technical Writer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Audience researchPositioningCampaign planningCopywritingAnalyticsExperimentation

### Education requirements

A degree in marketing, communications, business, or equivalent evidence of successful campaign workWorking knowledge of audience research, positioning, measurement, experimentation, and responsible data use

### Training and development

Message testing labsMarketing automation exercisesMeasurement-plan workshopsPrivacy and consent trainingConversion research practice

### Professional certifications

Google Analytics certification

### Core skills

Audience researchPositioningCampaign planningCopywritingAnalyticsExperimentationChannel strategyPerformance reporting

### Trending and emerging skills

Marketing automationIncrementality testingAI-assisted content operationsLifecycle marketingFirst-party data strategyGenerative search optimizationPrivacy-preserving attributionSynthetic audience researchConversational discovery

### Key responsibilities

Own the planning and delivery of work in the Technical Writer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contributionInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Channel budget and revenue responsibilityDemonstrated acquisition or retention impactAnalytics and experimentation depthMarket and audience complexityBrand or lifecycle ownershipAbility to coordinate creative, data, and commercial teams

### Typical career path

Junior content or editorial roleTechnical WriterSenior Technical WriterContent strategy, editorial leadership, brand communication, or independent practice

### Work specifics

Distributed marketing team working from campaign briefs, shared calendars, experimentation plans, and performance dashboardsPartners with sales, product, design, content, data, customer teams, and external specialistsUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGoogle Analytics 4HubSpotAhrefsSemrushLooker StudioCRM platformsProject tracking

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/es/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/es/affiliate-program-manager.md)[AI Content Editor →](https://jobicy.com/salaries/es/ai-content-editor.md)[AI Engineer →](https://jobicy.com/salaries/es/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/es/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/es/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/es/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/es/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/es/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/es/blockchain-security-analyst.md)[Brand Content Strategist →](https://jobicy.com/salaries/es/brand-content-strategist.md)[Brand Strategist →](https://jobicy.com/salaries/es/brand-strategist.md)[Cloud Architect →](https://jobicy.com/salaries/es/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/es/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/es/cloud-solutions-architect.md)[Content Designer →](https://jobicy.com/salaries/es/content-designer.md)Market intelligence

## Hiring context for Technical Writer in Spain.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Rising demand for remote-first positions with enhanced digital security measures and virtual onboarding processes

###

Key industries

Software as a ServiceE-commerceMedia and PublishingConsumer ProductsFinTechDigital AgenciesCross-country pay scale

## Compare Technical Writer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$58,40060% higher](https://jobicy.com/salaries/ae/technical-writer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$46,70028% higher](https://jobicy.com/salaries/at/technical-writer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$75,800107% higher](https://jobicy.com/salaries/au/technical-writer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$53,10045% higher](https://jobicy.com/salaries/be/technical-writer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$72,90099% higher](https://jobicy.com/salaries/ca/technical-writer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$93,900157% higher](https://jobicy.com/salaries/ch/technical-writer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$60,80066% higher](https://jobicy.com/salaries/de/technical-writer.md)[![France flag](https://cloud.jobicy.com/nyc4-cold/img/flags/fr.svg) France$47,90031% higher](https://jobicy.com/salaries/fr/technical-writer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Technical Writer salary in Spain?

The estimated average annual salary is $36,600. Junior roles are estimated at $21,300–$28,200, while senior roles are estimated at $43,400–$68,000.

What is the hourly rate for this role?

The estimated hourly equivalent is between $11.44 and $27.27 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Audience research, Positioning, Campaign planning, Copywriting, Analytics. Trending and emerging requirements include Marketing automation, Incrementality testing, AI-assisted content operations, Lifecycle marketing, First-party data strategy.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Technical Writer in Spain, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Spain and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Technical Writer in Spain, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Technical%20Writer.md)[Salary API](https://jobicy.com/salary-api.md)