[Salaries in France](https://jobicy.com/salaries/fr.md)2026 Salary Report

# Financial Planning Analyst salary in France.

The core purpose of a Financial Planning Analyst is practical: the professional builds budgets, forecasts, scenarios, and performance narratives that guide resource allocation. Day-to-day priorities vary by company, but performance is generally visible in forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For France, this report combines salary benchmarks in EUR with modeled assumptions for a 45% tax rate, 25 days of annual leave, and a 74.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$54,200Estimated annual average$2,484Estimated monthly take-home$16.94–$40.39Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy422 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$54,200Annual benchmarkJunior$32,100–$44,0000-2 yearsMid-level$42,900–$64,7003-5 yearsSenior$63,000–$94,7006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 45% tax rate$2,484Hourly equivalentBased on a standard 40-hour week$16.94–$40.39Potential annual bonusIllustrative 10–15% performance range$5,420–$8,130

### Planning reference

Monthly savings target25% illustrative allocation$1,100Retirement contribution14% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $900Emergency fundThree to six months of gross income$13,550–$27,100

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 45% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Financial Planning Analyst pay in France.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Financial Planning Analyst in France](https://jobicy.com/api/jpgraph/chart.php?junior_min=32100&junior_max=44000&middle_min=42900&middle_max=64700&senior_min=63000&senior_max=94700&average=54200&currency=%24&currency_code=USD&title=Financial%20Planning%20Analyst&country=France)
Salary ranges

Enlarge
![Salary progression by experience for Financial Planning Analyst in France](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=38050&m_avg=53800&s_avg=78850&currency=%24&currency_code=USD&title=Financial%20Planning%20Analyst&country=France)
Experience growthEnlarge
![Illustrative monthly salary allocation for Financial Planning Analyst in France](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2033&savings=1143&retirement=637&housing=903&disposable=0&currency=%24&currency_code=USD&title=Financial%20Planning%20Analyst&country=France)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.7% over the displayed period, moving from $53,300 to $54,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$54,200$17–$40Sep 2026$55,900$17–$42Aug 2026$56,500$18–$42Jul 2026$53,200$17–$40Jun 2026$57,100$18–$43May 2026$55,100$17–$41Apr 2026$54,500$17–$41Mar 2026$53,400$17–$40Feb 2026$55,900$17–$42Jan 2026$56,400$18–$42Dec 2025$52,300$16–$39Nov 2025$53,300$17–$40Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![hims & hers logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2023/11/e7b9b920-221.jpeg) Financial Analyst, FP&Ahims & hers→](https://jobicy.com/jobs/154913-financial-analyst-fpa-2.md) [![Demandbase, Inc. logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/664c17c5-221.jpg) Advertising Campaign StrategistDemandbase, Inc.→](https://jobicy.com/jobs/154853-advertising-campaign-strategist.md) [![Stripe logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/10/WRILS-201011073943-272457.png) Credit Operations ManagerStripe→](https://jobicy.com/jobs/154732-credit-operations-manager.md) [![Mozilla logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/10/mozilla.jpg) Senior Financial AnalystMozilla→](https://jobicy.com/jobs/154696-senior-financial-analyst-3.md) [![Algolia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201202014849-982609.jpg) Senior Technical Onboarding & Engagement ManagerAlgolia→](https://jobicy.com/jobs/154619-senior-technical-onboarding-engagement-manager.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Planning%20Analyst.md)Career profile

## Pay drivers and skills for Financial Planning Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliation

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Automation and systems labsFinancial modeling practiceControl and compliance refreshersScenario-planning workshopsData visualization training

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Financial modelingForecastingVariance analysisManagement reportingFinancial analysisReconciliationControlsReportingBusiness partnering

### Trending and emerging skills

Integrated business planningContinuous planningFinance automationScenario modelingReal-time reportingAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Financial Planning Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Financial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposureInfluence on capital and operating decisions

### Typical career path

Entry-level or associate role in the disciplineFinancial Planning AnalystSenior Financial Planning AnalystSenior analyst, finance manager, controllership, treasury, or finance leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseExcelGoogle SheetsERP systemsPower BISQLPlanning softwareReconciliation tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceCompulsory Health Insurance IntegrationExtended Paid Parental LeaveMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Financial Analyst →](https://jobicy.com/salaries/fr/financial-analyst.md)[Financial Data Analyst →](https://jobicy.com/salaries/fr/financial-data-analyst.md)[Financial Reporting Manager →](https://jobicy.com/salaries/fr/financial-reporting-manager.md)[Financial Systems Manager →](https://jobicy.com/salaries/fr/financial-systems-manager.md)[Fintech Product Manager →](https://jobicy.com/salaries/fr/fintech-product-manager.md)[Investment Operations Manager →](https://jobicy.com/salaries/fr/investment-operations-manager.md)[Payment Systems Analyst →](https://jobicy.com/salaries/fr/payment-systems-analyst.md)[Token Economist →](https://jobicy.com/salaries/fr/token-economist.md)Market intelligence

## Hiring context for Financial Planning Analyst in France.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Development of location-independent compensation models based on skills and performance rather than geography

###

Key industries

Financial ServicesFinTechBankingInvestment ManagementSoftware as a ServiceE-commerceCross-country pay scale

## Compare Financial Planning Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$69,90029% higher](https://jobicy.com/salaries/ae/financial-planning-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$52,3004% lower](https://jobicy.com/salaries/at/financial-planning-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$91,80069% higher](https://jobicy.com/salaries/au/financial-planning-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$61,40013% higher](https://jobicy.com/salaries/be/financial-planning-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$85,50058% higher](https://jobicy.com/salaries/ca/financial-planning-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$114,700112% higher](https://jobicy.com/salaries/ch/financial-planning-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$76,60041% higher](https://jobicy.com/salaries/de/financial-planning-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$44,50018% lower](https://jobicy.com/salaries/es/financial-planning-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Financial Planning Analyst salary in France?

The estimated average annual salary is $54,200. Junior roles are estimated at $32,100–$44,000, while senior roles are estimated at $63,000–$94,700.

What is the hourly rate for this role?

The estimated hourly equivalent is between $16.94 and $40.39 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Financial modeling, Forecasting, Variance analysis, Management reporting, Financial analysis. Trending and emerging requirements include Integrated business planning, Continuous planning, Finance automation, Scenario modeling, Real-time reporting.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Financial Planning Analyst in France, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for France and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Financial Planning Analyst in France, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Financial%20Planning%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)