[Salaries in France](https://jobicy.com/salaries/fr.md)2026 Salary Report

# Gaming Community Manager salary in France.

In a remote organization, a Gaming Community Manager builds healthy member relationships, programs, moderation practices, feedback loops, and measurable participation. The position rewards independent ownership, documented reasoning, and continuous improvement across resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuse. For France, this report combines salary benchmarks in EUR with modeled assumptions for a 45% tax rate, 25 days of annual leave, and a 74.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$38,900Estimated annual average$1,783Estimated monthly take-home$12.16–$28.99Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy502 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$38,900Annual benchmarkJunior$24,200–$30,3000-2 yearsMid-level$31,500–$46,6003-5 yearsSenior$47,300–$72,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 45% tax rate$1,783Hourly equivalentBased on a standard 40-hour week$12.16–$28.99Potential annual bonusIllustrative 10–15% performance range$3,890–$5,835

### Planning reference

Monthly savings target22% illustrative allocation$700Retirement contribution13% illustrative allocation$400Housing budgetIllustrative 20% monthly ceilingUp to $600Emergency fundThree to six months of gross income$9,725–$19,450

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 45% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Gaming Community Manager pay in France.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Gaming Community Manager in France](https://jobicy.com/api/jpgraph/chart.php?junior_min=24200&junior_max=30300&middle_min=31500&middle_max=46600&senior_min=47300&senior_max=72400&average=38900&currency=%24&currency_code=USD&title=Gaming%20Community%20Manager&country=France)
Salary ranges

Enlarge
![Salary progression by experience for Gaming Community Manager in France](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=27250&m_avg=39050&s_avg=59850&currency=%24&currency_code=USD&title=Gaming%20Community%20Manager&country=France)
Experience growthEnlarge
![Illustrative monthly salary allocation for Gaming Community Manager in France](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1459&savings=700&retirement=415&housing=648&disposable=19&currency=%24&currency_code=USD&title=Gaming%20Community%20Manager&country=France)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3.7% over the displayed period, moving from $37,500 to $38,900.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$38,900$12–$29Sep 2026$40,400$13–$30Aug 2026$37,800$12–$28Jul 2026$40,100$13–$30Jun 2026$38,200$12–$28May 2026$37,600$12–$28Apr 2026$39,900$12–$30Mar 2026$39,300$12–$29Feb 2026$38,500$12–$29Jan 2026$36,800$12–$27Dec 2025$37,200$12–$28Nov 2025$37,500$12–$28Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Discord logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/02/WRILS-210216185819-522054.jpg) Senior Stock AdministratorDiscord→](https://jobicy.com/jobs/152902-senior-stock-administrator-2.md) [![Discord logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/02/WRILS-210216185819-522054.jpg) Engineering Manager, Machine Learning (Safety)Discord→](https://jobicy.com/jobs/154851-engineering-manager-machine-learning-safety.md) [![Discord logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/02/WRILS-210216185819-522054.jpg) Engineering Manager, Platform SecurityDiscord→](https://jobicy.com/jobs/154856-engineering-manager-platform-security.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Gaming%20Community%20Manager.md)Career profile

## Pay drivers and skills for Gaming Community Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Community moderationMember programmingCrisis communicationFeedback synthesisCustomer communicationTroubleshooting

### Education requirements

Relevant higher education or equivalent customer-facing and domain-specific experienceEvidence of clear written communication, structured troubleshooting, sound judgment, and empathetic service

### Training and development

De-escalation practiceQuality calibration sessionsAccessibility and inclusive service trainingKnowledge-base writing workshopsProduct troubleshooting labs

### Core skills

Community moderationMember programmingCrisis communicationFeedback synthesisCustomer communicationTroubleshootingCase managementDe-escalationKnowledge management

### Trending and emerging skills

AI-assisted serviceCustomer health scoringSelf-service designSupport operations analyticsOmnichannel supportAgent-assist systemsPredictive case routingMultilingual automationProactive support

### Key responsibilities

Own the planning and delivery of work in the Gaming Community Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuseInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipProduct and troubleshooting complexityCustomer segment and service-level responsibilityEscalation and incident ownershipMultilingual or specialized domain capabilityQuality and knowledge-management impact

### Typical career path

Senior individual contributor or team leadGaming Community ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote customer team using documented escalation paths, shared knowledge, quality reviews, and service-level targetsWorks with customers, product, engineering, operations, sales, and success teams to resolve issues and prevent recurrenceFollows documented service coverage and escalation schedules, with live overlap during assigned customer-support hoursDiscordTelegramCircleZendeskIntercomSlackNotionCRM platforms

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowancePerformance BonusesConference Attendance SupportCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/fr/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/fr/affiliate-program-manager.md)[AI Content Editor →](https://jobicy.com/salaries/fr/ai-content-editor.md)[Brand Content Strategist →](https://jobicy.com/salaries/fr/brand-content-strategist.md)[Brand Strategist →](https://jobicy.com/salaries/fr/brand-strategist.md)[Chat Support Lead →](https://jobicy.com/salaries/fr/chat-support-lead.md)[Community Success Manager →](https://jobicy.com/salaries/fr/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/fr/content-designer.md)[Content Optimization Lead →](https://jobicy.com/salaries/fr/content-optimization-lead.md)[Content Quality Manager →](https://jobicy.com/salaries/fr/content-quality-manager.md)[Content Strategist →](https://jobicy.com/salaries/fr/content-strategist.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/fr/conversion-optimization-manager.md)[Conversion Rate Specialist →](https://jobicy.com/salaries/fr/conversion-rate-specialist.md)[Copywriter →](https://jobicy.com/salaries/fr/copywriter.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/fr/customer-acquisition-manager.md)[Customer Experience Analyst →](https://jobicy.com/salaries/fr/customer-experience-analyst.md)Market intelligence

## Hiring context for Gaming Community Manager in France.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Transition to distributed team structures with emphasis on cross-timezone collaboration and cultural awareness

###

Key industries

Software as a ServiceE-commerceFinTechConsumer TechnologyHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Gaming Community Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$51,30032% higher](https://jobicy.com/salaries/ae/gaming-community-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$36,0007% lower](https://jobicy.com/salaries/at/gaming-community-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$61,90059% higher](https://jobicy.com/salaries/au/gaming-community-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$44,10013% higher](https://jobicy.com/salaries/be/gaming-community-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$59,60053% higher](https://jobicy.com/salaries/ca/gaming-community-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$83,400114% higher](https://jobicy.com/salaries/ch/gaming-community-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$51,70033% higher](https://jobicy.com/salaries/de/gaming-community-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$30,00023% lower](https://jobicy.com/salaries/es/gaming-community-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Gaming Community Manager salary in France?

The estimated average annual salary is $38,900. Junior roles are estimated at $24,200–$30,300, while senior roles are estimated at $47,300–$72,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $12.16 and $28.99 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Community moderation, Member programming, Crisis communication, Feedback synthesis, Customer communication. Trending and emerging requirements include AI-assisted service, Customer health scoring, Self-service design, Support operations analytics, Omnichannel support.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Gaming Community Manager in France, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for France and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Gaming Community Manager in France, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Gaming%20Community%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)