[Salaries in France](https://jobicy.com/salaries/fr.md)2026 Salary Report

# Machine Learning Specialist salary in France.

The average salary for Machine Learning Specialist in France is $80,900 per year, according to Jobicy salary data updated 12 Oct 2026. Entry-level positions start around $49,500–$64,600, while experienced professionals earn $97,100–$152,200.
Average compensation has increased 7% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 12 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$80,900Estimated annual average$3,708Estimated monthly take-home$25.28–$60.29Hourly equivalent range12 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Machine Learning Specialist role develops, evaluates, deploys, and monitors machine-learning solutions for practical product or business use. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include model quality, latency, reliability, safety, adoption, and inference cost. For France, this report combines salary benchmarks in EUR with modeled assumptions for a 45% tax rate, 25 days of annual leave, and a 74.0 cost-of-living index relative to the United States baseline.

High accuracy629 recent job listings and community reports shaped this estimateUpdated 12 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$80,900Annual benchmarkJunior$49,500–$64,6000-2 yearsMid-level$63,900–$96,4003-5 yearsSenior$97,100–$152,2006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 45% tax rate$3,708Hourly equivalentBased on a standard 40-hour week$25.28–$60.29Potential annual bonusIllustrative 10–15% performance range$8,090–$12,135

### Planning reference

Monthly savings target34% illustrative allocation$2,300Retirement contribution14% illustrative allocation$900Housing budgetIllustrative 20% monthly ceilingUp to $1,300Emergency fundThree to six months of gross income$20,225–$40,450

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 45% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Machine Learning Specialist pay in France.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Machine Learning Specialist in France](https://jobicy.com/api/jpgraph/chart.php?junior_min=49500&junior_max=64600&middle_min=63900&middle_max=96400&senior_min=97100&senior_max=152200&average=80900&currency=%24&currency_code=USD&title=Machine%20Learning%20Specialist&country=France)
Salary ranges

Enlarge
![Salary progression by experience for Machine Learning Specialist in France](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=57050&m_avg=80150&s_avg=124650&currency=%24&currency_code=USD&title=Machine%20Learning%20Specialist&country=France)
Experience growthEnlarge
![Illustrative monthly salary allocation for Machine Learning Specialist in France](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=3034&savings=2306&retirement=944&housing=1348&disposable=0&currency=%24&currency_code=USD&title=Machine%20Learning%20Specialist&country=France)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 7% over the displayed period, moving from $75,600 to $80,900.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$80,900$25–$60Sep 2026$79,900$25–$60Aug 2026$83,800$26–$62Jul 2026$81,500$25–$61Jun 2026$81,300$25–$61May 2026$81,900$26–$61Apr 2026$82,100$26–$61Mar 2026$80,000$25–$60Feb 2026$80,500$25–$60Jan 2026$80,300$25–$60Dec 2025$76,100$24–$57Nov 2025$75,600$24–$56Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Monzo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5b4c0ec3-221.jpg) Data Director, PaymentsMonzo→](https://jobicy.com/jobs/155583-data-director-payments.md) [![Fleetio logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2023/07/e571b83c37e0ed5371754d319be16e76.jpeg) Senior Applied Data Scientist, Fleet IntelligenceFleetio→](https://jobicy.com/jobs/155336-senior-applied-data-scientist-fleet-intelligence.md) [![Cloudbeds logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/3aef1a38-221.png) Accounting Specialist - LATAMCloudbeds→](https://jobicy.com/jobs/152965-accounting-specialist-latam.md) [![Cloudbeds logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/3aef1a38-221.png) Director of Customer SupportCloudbeds→](https://jobicy.com/jobs/152994-director-of-customer-support-2.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Machine%20Learning%20Specialist.md)Career profile

## Pay drivers and skills for Machine Learning Specialist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 4-7 years of directly relevant experience supported by evidence of independent, high-impact delivery

### Required skills

PythonMachine learningModel evaluationData preparationExperiment designSoftware engineering

### Education requirements

A degree in computer science, machine learning, mathematics, or equivalent applied experienceA portfolio showing model evaluation, data handling, and production implementation

### Training and development

Responsible AI and governance trainingProduction inference optimizationData quality workshopsMLOps deployment labsModel evaluation and red-team exercises

### Core skills

PythonMachine learningModel evaluationData preparationExperiment designSoftware engineeringStatisticsResponsible AI

### Trending and emerging skills

Vector searchModel observabilityLarge language modelsRetrieval-augmented generationMLOpsAI agentsMultimodal systemsSynthetic dataSmall language models

### Key responsibilities

Own the planning and delivery of work in the Machine Learning Specialist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against model quality, latency, reliability, safety, adoption, and inference costInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Model and data complexityProduction deployment experienceEvaluation, safety, and governance expertiseInference performance and cost ownershipDomain-specific AI knowledgeAbility to connect research with product outcomes

### Typical career path

Entry-level or associate role in the disciplineMachine Learning SpecialistSenior Machine Learning SpecialistLead AI specialist, AI operations leadership, research engineering, or AI product leadership

### Work specifics

Cross-functional AI product team combining experimentation with production engineering and documented model governancePartners with data, product, legal, security, and platform teams to move models into reliable useUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responsePythonPyTorchHugging FaceMLflowDockerGitCloud ML platforms

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/fr/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/fr/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/fr/analytics-implementation-manager.md)[API Integration Specialist →](https://jobicy.com/salaries/fr/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/fr/automation-engineer.md)[Blockchain Analyst →](https://jobicy.com/salaries/fr/blockchain-analyst.md)[Blockchain Developer →](https://jobicy.com/salaries/fr/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/fr/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/fr/blockchain-security-analyst.md)[Business Analyst →](https://jobicy.com/salaries/fr/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/fr/business-intelligence-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/fr/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/fr/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/fr/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/fr/cplusplus-developer.md)[Customer Experience Analyst →](https://jobicy.com/salaries/fr/customer-experience-analyst.md)Market intelligence

## Hiring context for Machine Learning Specialist in France.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Focus on digital well-being and work-life balance initiatives specific to remote work environments

###

Key industries

EdTechCorporate LearningHigher EducationProfessional TrainingCross-country pay scale

## Compare Machine Learning Specialist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$103,60028% higher](https://jobicy.com/salaries/ae/machine-learning-specialist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$78,2003% lower](https://jobicy.com/salaries/at/machine-learning-specialist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$124,90054% higher](https://jobicy.com/salaries/au/machine-learning-specialist.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$86,6007% higher](https://jobicy.com/salaries/be/machine-learning-specialist.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$122,20051% higher](https://jobicy.com/salaries/ca/machine-learning-specialist.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$173,100114% higher](https://jobicy.com/salaries/ch/machine-learning-specialist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$103,90028% higher](https://jobicy.com/salaries/de/machine-learning-specialist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$64,80020% lower](https://jobicy.com/salaries/es/machine-learning-specialist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Machine Learning Specialist salary in France?

The estimated average annual salary is $80,900. Junior roles are estimated at $49,500–$64,600, while senior roles are estimated at $97,100–$152,200.

What is the hourly rate for this role?

The estimated hourly equivalent is between $25.28 and $60.29 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Python, Machine learning, Model evaluation, Data preparation, Experiment design. Trending and emerging requirements include Vector search, Model observability, Large language models, Retrieval-augmented generation, MLOps.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Machine Learning Specialist in France, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for France and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Machine Learning Specialist in France, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Machine%20Learning%20Specialist.md)[Salary API](https://jobicy.com/salary-api.md)