[Salaries in France](https://jobicy.com/salaries/fr.md)2026 Salary Report

# Operations Analyst salary in France.

The average salary for Operations Analyst in France is $48,600 per year, according to Jobicy salary data updated 11 Oct 2026. Entry-level positions start around $28,500–$40,100, while experienced professionals earn $57,200–$86,500.
Average compensation has increased 5.9% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 11 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$48,600Estimated annual average$2,228Estimated monthly take-home$15.19–$36.22Hourly equivalent range11 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

An Operations Analyst uses process and performance data to diagnose operational constraints and test practical improvements. The work combines subject-matter judgment with disciplined execution and is commonly assessed through accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For France, this report combines salary benchmarks in EUR with modeled assumptions for a 45% tax rate, 25 days of annual leave, and a 74.0 cost-of-living index relative to the United States baseline.

High accuracy523 recent job listings and community reports shaped this estimateUpdated 11 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$48,600Annual benchmarkJunior$28,500–$40,1000-2 yearsMid-level$39,700–$58,3003-5 yearsSenior$57,200–$86,5006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 45% tax rate$2,228Hourly equivalentBased on a standard 40-hour week$15.19–$36.22Potential annual bonusIllustrative 10–15% performance range$4,860–$7,290

### Planning reference

Monthly savings target24% illustrative allocation$1,000Retirement contribution14% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $800Emergency fundThree to six months of gross income$12,150–$24,300

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 45% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Operations Analyst pay in France.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Operations Analyst in France](https://jobicy.com/api/jpgraph/chart.php?junior_min=28500&junior_max=40100&middle_min=39700&middle_max=58300&senior_min=57200&senior_max=86500&average=48600&currency=%24&currency_code=USD&title=Operations%20Analyst&country=France)
Salary ranges

Enlarge
![Salary progression by experience for Operations Analyst in France](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=34300&m_avg=49000&s_avg=71850&currency=%24&currency_code=USD&title=Operations%20Analyst&country=France)
Experience growthEnlarge
![Illustrative monthly salary allocation for Operations Analyst in France](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1823&savings=960&retirement=559&housing=810&disposable=0&currency=%24&currency_code=USD&title=Operations%20Analyst&country=France)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 5.9% over the displayed period, moving from $45,900 to $48,600.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$48,600$15–$36Sep 2026$49,100$15–$37Aug 2026$46,600$15–$35Jul 2026$45,400$14–$34Jun 2026$47,500$15–$35May 2026$46,900$15–$35Apr 2026$45,000$14–$34Mar 2026$47,000$15–$35Feb 2026$46,600$15–$35Jan 2026$45,200$14–$34Dec 2025$44,700$14–$33Nov 2025$45,900$14–$34Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Cribl logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/65d82c04-221.jpeg) Director, Product Management (Security)Cribl→](https://jobicy.com/jobs/155613-director-product-management-security.md) [![PerfectServe logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/7e6f5669fc8c9ea0aa484ce7c3058599.jpg) Enterprise Implementation Consultant - US RemotePerfectServe→](https://jobicy.com/jobs/155605-enterprise-implementation-consultant-us-remote.md) [![PerfectServe logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/7e6f5669fc8c9ea0aa484ce7c3058599.jpg) Data Engineer - US RemotePerfectServe→](https://jobicy.com/jobs/155602-data-engineer-us-remote.md) [![PerfectServe logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/7e6f5669fc8c9ea0aa484ce7c3058599.jpg) Customer & Field Marketing Manager - US RemotePerfectServe→](https://jobicy.com/jobs/155598-customer-field-marketing-manager-us-remote-3.md) [![dscout logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/03/f81f478b71cf9399121a6f91aafc0bd3.jpeg) GTM Systems Administratordscout→](https://jobicy.com/jobs/155571-gtm-systems-administrator.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Operations%20Analyst.md)Career profile

## Pay drivers and skills for Operations Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Process mappingCapacity planningControl designOperational metricsSQLData analysis

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Advanced SQL and query optimizationData governance workshopsExperiment design practiceDashboard accessibility reviewsPrivacy-aware analytics training

### Core skills

Process mappingCapacity planningControl designOperational metricsSQLData analysisStatisticsData qualityData modeling

### Trending and emerging skills

Semantic layersSelf-service analyticsModern data stacksAnalytics engineeringData governanceVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Operations Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Data volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experienceInfluence on high-value decisions

### Typical career path

Entry-level or associate role in the disciplineOperations AnalystSenior Operations AnalystLead analyst, analytics management, data science, or data-platform leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtTableauPower BISnowflakeGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/fr/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/fr/affiliate-program-manager.md)[AI Engineer →](https://jobicy.com/salaries/fr/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/fr/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/fr/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/fr/animation-director.md)[Blockchain Analyst →](https://jobicy.com/salaries/fr/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/fr/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/fr/business-development-manager.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/fr/business-intelligence-analyst.md)[Change Management Consultant →](https://jobicy.com/salaries/fr/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/fr/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/fr/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/fr/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/fr/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/fr/conversion-optimization-manager.md)Market intelligence

## Hiring context for Operations Analyst in France.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Implementation of flexible scheduling options including compressed workweeks and core collaboration hours

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Operations Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$62,70029% higher](https://jobicy.com/salaries/ae/operations-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$45,2007% lower](https://jobicy.com/salaries/at/operations-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$77,10059% higher](https://jobicy.com/salaries/au/operations-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$52,7008% higher](https://jobicy.com/salaries/be/operations-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$74,10052% higher](https://jobicy.com/salaries/ca/operations-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$101,600109% higher](https://jobicy.com/salaries/ch/operations-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$60,90025% higher](https://jobicy.com/salaries/de/operations-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$37,40023% lower](https://jobicy.com/salaries/es/operations-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Operations Analyst salary in France?

The estimated average annual salary is $48,600. Junior roles are estimated at $28,500–$40,100, while senior roles are estimated at $57,200–$86,500.

What is the hourly rate for this role?

The estimated hourly equivalent is between $15.19 and $36.22 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Process mapping, Capacity planning, Control design, Operational metrics, SQL. Trending and emerging requirements include Semantic layers, Self-service analytics, Modern data stacks, Analytics engineering, Data governance.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Operations Analyst in France, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for France and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Operations Analyst in France, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Operations%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)