[Salaries in France](https://jobicy.com/salaries/fr.md)2026 Salary Report

# Security Compliance Manager salary in France.

The average salary for Security Compliance Manager in France is $72,100 per year, according to Jobicy salary data updated 6 Oct 2026. Entry-level positions start around $44,600–$57,400, while experienced professionals earn $88,700–$135,300.
Average compensation has increased 8.3% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 6 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$72,100Estimated annual average$3,305Estimated monthly take-home$22.53–$53.73Hourly equivalent range6 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

In a remote organization, a Security Compliance Manager maps security obligations to evidence-backed controls, assessments, remediation, and audit readiness. The position rewards independent ownership, documented reasoning, and continuous improvement across control effectiveness, remediation quality, audit readiness, regulatory timeliness, risk reduction, and decision clarity. For France, this report combines salary benchmarks in EUR with modeled assumptions for a 45% tax rate, 25 days of annual leave, and a 74.0 cost-of-living index relative to the United States baseline.

Reliable accuracy463 recent job listings and community reports shaped this estimateUpdated 6 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$72,100Annual benchmarkJunior$44,600–$57,4000-2 yearsMid-level$57,600–$87,6003-5 yearsSenior$88,700–$135,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 45% tax rate$3,305Hourly equivalentBased on a standard 40-hour week$22.53–$53.73Potential annual bonusIllustrative 10–15% performance range$7,210–$10,815

### Planning reference

Monthly savings target28% illustrative allocation$1,700Retirement contribution12% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,200Emergency fundThree to six months of gross income$18,025–$36,050

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 45% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Security Compliance Manager pay in France.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Security Compliance Manager in France](https://jobicy.com/api/jpgraph/chart.php?junior_min=44600&junior_max=57400&middle_min=57600&middle_max=87600&senior_min=88700&senior_max=135300&average=72100&currency=%24&currency_code=USD&title=Security%20Compliance%20Manager&country=France)
Salary ranges

Enlarge
![Salary progression by experience for Security Compliance Manager in France](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=51000&m_avg=72600&s_avg=112000&currency=%24&currency_code=USD&title=Security%20Compliance%20Manager&country=France)
Experience growthEnlarge
![Illustrative monthly salary allocation for Security Compliance Manager in France](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2704&savings=1688&retirement=697&housing=1202&disposable=0&currency=%24&currency_code=USD&title=Security%20Compliance%20Manager&country=France)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 8.3% over the displayed period, moving from $66,600 to $72,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$72,100$23–$54Sep 2026$67,600$21–$50Aug 2026$69,500$22–$52Jul 2026$68,200$21–$51Jun 2026$70,000$22–$52May 2026$69,200$22–$52Apr 2026$68,700$21–$51Mar 2026$68,800$22–$51Feb 2026$66,200$21–$49Jan 2026$68,400$21–$51Dec 2025$69,400$22–$52Nov 2025$66,600$21–$50Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![CertiK logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210308091023-955845.jpg) Lead Product Manager, Digital AssetsCertiK→](https://jobicy.com/jobs/155441-lead-product-manager-digital-assets.md) [![Tenable logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/01879e02-221.jpg) Regional Sales DirectorTenable→](https://jobicy.com/jobs/155432-regional-sales-director-2.md) [![Binance logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/bc822f38-221.jpg) P2P Growth Operations Manager (CIS/CEE)Binance→](https://jobicy.com/jobs/155438-p2p-growth-operations-manager-cis-cee.md) [![GitLab logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201207055737-109952.jpg) Associate Renewals ManagerGitLab→](https://jobicy.com/jobs/155427-associate-renewals-manager.md) [![GitLab logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201207055737-109952.jpg) Account Executive - FranceGitLab→](https://jobicy.com/jobs/155424-account-executive-france.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Security%20Compliance%20Manager.md)Career profile

## Pay drivers and skills for Security Compliance Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Control mappingAudit evidencePolicy managementRegulatory monitoringRegulatory analysisPolicy design

### Education requirements

A degree in law, public policy, information governance, risk, technology, or equivalent regulatory experienceDemonstrated ability to interpret obligations and translate them into proportionate, testable operational controls

### Training and development

Audit and evidence simulationsIncident and breach exercisesExecutive risk communication practiceRegulatory update briefingsControl-design workshops

### Professional certifications

Relevant privacy, compliance, audit, or risk certification when applicable

### Core skills

Control mappingAudit evidencePolicy managementRegulatory monitoringRegulatory analysisPolicy designRisk assessmentControl designIssue management

### Trending and emerging skills

Continuous complianceAI governancePrivacy engineeringAutomated control testingThird-party risk managementMachine-readable regulationAlgorithmic accountabilityPrivacy-enhancing technologiesDigital identity assurance

### Key responsibilities

Own the planning and delivery of work in the Security Compliance Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against control effectiveness, remediation quality, audit readiness, regulatory timeliness, risk reduction, and decision clarityCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Security clearance or regulated-environment experienceIncident severity and on-call scopeTeam size and people-management responsibilityBudget and portfolio ownershipRegulatory complexity and jurisdiction coverageControl and audit ownershipProfessional privacy, risk, or compliance credentials

### Typical career path

Senior individual contributor or team leadSecurity Compliance ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Independent governance function working through documented assessments, evidence, review forums, and confidential issue managementAdvises legal, security, data, product, engineering, finance, operations, and executive stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseBurp SuiteSIEMWiresharkGovernance platformsRisk registersPolicy repositoriesAudit workflow toolsData mapping tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceCompulsory Health Insurance IntegrationExtended Paid Parental LeaveMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/fr/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/fr/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/fr/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/fr/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/fr/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/fr/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/fr/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/fr/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/fr/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/fr/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/fr/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/fr/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/fr/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/fr/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/fr/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/fr/customer-success-director.md)Market intelligence

## Hiring context for Security Compliance Manager in France.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Transition to distributed team structures with emphasis on cross-timezone collaboration and cultural awareness

###

Key industries

Financial ServicesHealthcare TechnologySoftware as a ServiceCybersecurityLegal ServicesGovernment TechnologyCross-country pay scale

## Compare Security Compliance Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$90,10025% higher](https://jobicy.com/salaries/ae/security-compliance-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$64,90010% lower](https://jobicy.com/salaries/at/security-compliance-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$108,80051% higher](https://jobicy.com/salaries/au/security-compliance-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$77,9008% higher](https://jobicy.com/salaries/be/security-compliance-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$110,60053% higher](https://jobicy.com/salaries/ca/security-compliance-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$141,20096% higher](https://jobicy.com/salaries/ch/security-compliance-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$90,30025% higher](https://jobicy.com/salaries/de/security-compliance-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$54,60024% lower](https://jobicy.com/salaries/es/security-compliance-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Security Compliance Manager salary in France?

The estimated average annual salary is $72,100. Junior roles are estimated at $44,600–$57,400, while senior roles are estimated at $88,700–$135,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $22.53 and $53.73 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Control mapping, Audit evidence, Policy management, Regulatory monitoring, Regulatory analysis. Trending and emerging requirements include Continuous compliance, AI governance, Privacy engineering, Automated control testing, Third-party risk management.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Security Compliance Manager in France, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for France and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Security Compliance Manager in France, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Security%20Compliance%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)