[Salaries in France](https://jobicy.com/salaries/fr.md)2026 Salary Report

# Security Engineer salary in France.

The average salary for Security Engineer in France is $73,100 per year, according to Jobicy salary data updated 5 Oct 2026. Entry-level positions start around $43,600–$61,000, while experienced professionals earn $87,600–$125,800.
Average compensation has increased 2.7% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 5 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$73,100Estimated annual average$3,350Estimated monthly take-home$22.84–$54.47Hourly equivalent range5 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Security Engineer role builds preventive and detective security capabilities into applications, cloud platforms, and operational systems. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include risk reduction, detection coverage, remediation time, control effectiveness, and incident severity. For France, this report combines salary benchmarks in EUR with modeled assumptions for a 45% tax rate, 25 days of annual leave, and a 74.0 cost-of-living index relative to the United States baseline.

Reliable accuracy446 recent job listings and community reports shaped this estimateUpdated 5 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$73,100Annual benchmarkJunior$43,600–$61,0000-2 yearsMid-level$58,700–$90,8003-5 yearsSenior$87,600–$125,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 45% tax rate$3,350Hourly equivalentBased on a standard 40-hour week$22.84–$54.47Potential annual bonusIllustrative 10–15% performance range$7,310–$10,965

### Planning reference

Monthly savings target30% illustrative allocation$1,800Retirement contribution12% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,200Emergency fundThree to six months of gross income$18,275–$36,550

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 45% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Security Engineer pay in France.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Security Engineer in France](https://jobicy.com/api/jpgraph/chart.php?junior_min=43600&junior_max=61000&middle_min=58700&middle_max=90800&senior_min=87600&senior_max=125800&average=73100&currency=%24&currency_code=USD&title=Security%20Engineer&country=France)
Salary ranges

Enlarge
![Salary progression by experience for Security Engineer in France](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=52300&m_avg=74750&s_avg=106700&currency=%24&currency_code=USD&title=Security%20Engineer&country=France)
Experience growthEnlarge
![Illustrative monthly salary allocation for Security Engineer in France](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2741&savings=1797&retirement=701&housing=1218&disposable=0&currency=%24&currency_code=USD&title=Security%20Engineer&country=France)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2.7% over the displayed period, moving from $71,200 to $73,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$73,100$23–$54Sep 2026$76,900$24–$57Aug 2026$75,800$24–$56Jul 2026$75,700$24–$56Jun 2026$72,500$23–$54May 2026$76,500$24–$57Apr 2026$74,500$23–$56Mar 2026$73,200$23–$55Feb 2026$74,100$23–$55Jan 2026$74,900$23–$56Dec 2025$72,100$23–$54Nov 2025$71,200$22–$53Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Vercel logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/a6aded72-221.png) Security Software Engineer, IAMVercel→](https://jobicy.com/jobs/147750-security-software-engineer-iam.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Sales Engineer, EnterpriseSocket→](https://jobicy.com/jobs/153337-sales-engineer-enterprise-2.md) [![Quantum Metric logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/52363ead-221.jpg) Solutions Engineer - USQuantum Metric→](https://jobicy.com/jobs/153333-solutions-engineer-us.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Sales Engineer, CommercialSocket→](https://jobicy.com/jobs/153342-sales-engineer-commercial.md) [![Socket logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/1314ce3c-221.png) Forward Deployed Engineer, PythonSocket→](https://jobicy.com/jobs/153341-forward-deployed-engineer-python.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Security%20Engineer.md)Career profile

## Pay drivers and skills for Security Engineer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 4-7 years of directly relevant experience supported by evidence of independent, high-impact delivery

### Required skills

Threat modelingSecurity testingRisk assessmentIncident responseNetwork securityIdentity and access management

### Education requirements

A degree in cybersecurity, computer science, or equivalent hands-on security experienceDemonstrated knowledge of threat modeling, secure systems, incident handling, and responsible disclosure

### Training and development

Cloud security labsSecure code review practiceResponsible disclosure trainingIncident response exercisesThreat-modeling workshops

### Professional certifications

Security+

### Core skills

Threat modelingSecurity testingRisk assessmentIncident responseNetwork securityIdentity and access managementSecurity documentationVulnerability management

### Trending and emerging skills

Software supply-chain securityDetection engineeringSecurity automationZero trustCloud security posture managementAI security testingPasskey adoptionConfidential computingPost-quantum readiness

### Key responsibilities

Own the planning and delivery of work in the Security Engineer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against risk reduction, detection coverage, remediation time, control effectiveness, and incident severityCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Security clearance or regulated-environment experienceIncident severity and on-call scopeThreat exposure and system criticalityCloud and application security depthIncident-response responsibilityRelevant security certificationsRegulatory and audit complexity

### Typical career path

Entry-level or associate role in the disciplineSecurity EngineerSenior Security EngineerSecurity lead, principal security specialist, security architecture, or security management

### Work specifics

Security team balancing proactive assurance, monitoring, incident response, and clear risk communicationWorks with engineering, IT, legal, compliance, and leadership to reduce practical security exposureUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseBurp SuiteSIEMWiresharkNmapGitCloud security toolsTicketing systems

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/fr/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/fr/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/fr/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/fr/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/fr/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/fr/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/fr/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/fr/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/fr/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/fr/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/fr/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/fr/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/fr/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/fr/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/fr/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/fr/devops-engineer.md)Market intelligence

## Hiring context for Security Engineer in France.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Transition to distributed team structures with emphasis on cross-timezone collaboration and cultural awareness

###

Key industries

CybersecurityFinancial ServicesCloud ComputingGovernment TechnologyHealthcare TechnologyE-commerceCross-country pay scale

## Compare Security Engineer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$99,30036% higher](https://jobicy.com/salaries/ae/security-engineer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$73,5001% higher](https://jobicy.com/salaries/at/security-engineer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$123,00068% higher](https://jobicy.com/salaries/au/security-engineer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$85,80017% higher](https://jobicy.com/salaries/be/security-engineer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$114,90057% higher](https://jobicy.com/salaries/ca/security-engineer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$151,400107% higher](https://jobicy.com/salaries/ch/security-engineer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$100,40037% higher](https://jobicy.com/salaries/de/security-engineer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$58,30020% lower](https://jobicy.com/salaries/es/security-engineer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Security Engineer salary in France?

The estimated average annual salary is $73,100. Junior roles are estimated at $43,600–$61,000, while senior roles are estimated at $87,600–$125,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $22.84 and $54.47 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Threat modeling, Security testing, Risk assessment, Incident response, Network security. Trending and emerging requirements include Software supply-chain security, Detection engineering, Security automation, Zero trust, Cloud security posture management.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Security Engineer in France, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for France and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Security Engineer in France, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Security%20Engineer.md)[Salary API](https://jobicy.com/salary-api.md)