[Salaries in Ireland](https://jobicy.com/salaries/ie.md)2026 Salary Report

# Creative Director salary in Ireland.

The Creative Director role sets creative direction and raises the quality and coherence of work across disciplines and channels. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarity. For Ireland, this report combines salary benchmarks in EUR with modeled assumptions for a 20% tax rate, 20 days of annual leave, and a 80.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$113,100Estimated annual average$7,540Estimated monthly take-home$35.34–$84.28Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1341 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$113,100Annual benchmarkJunior$68,500–$88,2000-2 yearsMid-level$88,300–$134,4003-5 yearsSenior$140,400–$202,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$7,540Hourly equivalentBased on a standard 40-hour week$35.34–$84.28Potential annual bonusIllustrative 10–15% performance range$11,310–$16,965

### Planning reference

Monthly savings target30% illustrative allocation$2,800Retirement contribution15% illustrative allocation$1,400Housing budgetIllustrative 20% monthly ceilingUp to $1,900Emergency fundThree to six months of gross income$28,275–$56,550

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 20% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Creative Director pay in Ireland.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Creative Director in Ireland](https://jobicy.com/api/jpgraph/chart.php?junior_min=68500&junior_max=88200&middle_min=88300&middle_max=134400&senior_min=140400&senior_max=202300&average=113100&currency=%24&currency_code=USD&title=Creative%20Director&country=Ireland)
Salary ranges

Enlarge
![Salary progression by experience for Creative Director in Ireland](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=78350&m_avg=111350&s_avg=171350&currency=%24&currency_code=USD&title=Creative%20Director&country=Ireland)
Experience growthEnlarge
![Illustrative monthly salary allocation for Creative Director in Ireland](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1885&savings=2837&retirement=1423&housing=1885&disposable=1395&currency=%24&currency_code=USD&title=Creative%20Director&country=Ireland)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 5% over the displayed period, moving from $107,700 to $113,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$113,100$35–$84Sep 2026$109,600$34–$82Aug 2026$114,600$36–$85Jul 2026$108,600$34–$81Jun 2026$112,100$35–$84May 2026$111,900$35–$83Apr 2026$107,800$34–$80Mar 2026$107,500$34–$80Feb 2026$108,000$34–$80Jan 2026$110,700$35–$82Dec 2025$104,900$33–$78Nov 2025$107,700$34–$80Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Smartsheet logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/8b6103bd-221.jpg) Enterprise Account ExecutiveSmartsheet→](https://jobicy.com/jobs/145581-enterprise-account-executive-6.md) [![Instrument logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/4bad3e7b155943ebf27d1da56ae2e258.jpg) Freelance Product and Brand Designers – Join Our NetworkInstrument→](https://jobicy.com/jobs/152896-freelance-product-and-brand-designers-join-our-network.md) [![Canonical logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b4d068a9-221-1.png) Content Marketing ManagerCanonical→](https://jobicy.com/jobs/148920-content-marketing-manager-3.md) [![Upstart logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/bc2cfa2b-221-1.jpeg) Art Director, Brand SocialUpstart→](https://jobicy.com/jobs/154937-art-director-brand-social.md) [![Twilio logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/10/WRILS-201023175858-722503.jpg) Director, Global CampaignsTwilio→](https://jobicy.com/jobs/154904-director-global-campaigns.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Creative%20Director.md)Career profile

## Pay drivers and skills for Creative Director.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 8+ years in the discipline, including ownership of strategy, people, budgets, or enterprise-level outcomes

### Required skills

Visual communicationDesign systemsPrototypingUser-centered designAccessibilityCritique

### Education requirements

A degree in design, visual communication, interaction design, or an equivalent professional portfolioA portfolio that explains process, constraints, iteration, and measurable outcomes rather than only final visuals

### Training and development

Advanced prototyping labsAccessibility and inclusive design reviewsFacilitated critique sessionsDesign-system contribution workshopsResearch synthesis practice

### Core skills

Visual communicationDesign systemsPrototypingUser-centered designAccessibilityCritiqueInformation hierarchyDesign documentation

### Trending and emerging skills

AI-assisted creative workflowsResponsive systemsInclusive designDesign operationsMotion principlesSpatial interfacesGenerative design systemsMultimodal prototypingReal-time 3D experiences

### Key responsibilities

Own the planning and delivery of work in the Creative Director remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarityCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Organization-wide strategy and executive accountabilityMulti-team and budget scopePortfolio quality and demonstrated outcomesProduct or brand complexityResearch and accessibility capabilityDesign-system ownershipAdvanced production-tool expertise

### Typical career path

Senior specialist or functional managerCreative DirectorVice President or Head of FunctionExecutive leadership or advisory work

### Work specifics

Remote creative team using shared design systems, documented feedback, and frequent prototype reviewsWorks closely with research, product, engineering, content, marketing, and brand stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseFigmaAdobe Creative CloudMiroNotionPrototyping toolsAsset librariesProject tracking

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[3D Artist →](https://jobicy.com/salaries/ie/3d-artist.md)[Account Based Marketing Manager →](https://jobicy.com/salaries/ie/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/ie/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/ie/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/ie/animation-director.md)[AR/VR Designer →](https://jobicy.com/salaries/ie/ar-vr-designer.md)[Business Analyst →](https://jobicy.com/salaries/ie/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/ie/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/ie/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/ie/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/ie/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/ie/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/ie/content-designer.md)[Content Quality Manager →](https://jobicy.com/salaries/ie/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/ie/conversion-optimization-manager.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/ie/customer-acquisition-manager.md)Market intelligence

## Hiring context for Creative Director in Ireland.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Focus on building strong remote company culture through regular virtual team activities and online community building

###

Key industries

Software as a ServiceE-commerceMedia and EntertainmentConsumer TechnologyGamingDigital AgenciesCross-country pay scale

## Compare Creative Director pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$100,00012% lower](https://jobicy.com/salaries/ae/creative-director.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$77,00032% lower](https://jobicy.com/salaries/at/creative-director.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$122,0008% higher](https://jobicy.com/salaries/au/creative-director.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$89,10021% lower](https://jobicy.com/salaries/be/creative-director.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$119,3005% higher](https://jobicy.com/salaries/ca/creative-director.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$161,20043% higher](https://jobicy.com/salaries/ch/creative-director.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$106,1006% lower](https://jobicy.com/salaries/de/creative-director.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$61,60046% lower](https://jobicy.com/salaries/es/creative-director.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Creative Director salary in Ireland?

The estimated average annual salary is $113,100. Junior roles are estimated at $68,500–$88,200, while senior roles are estimated at $140,400–$202,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $35.34 and $84.28 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Visual communication, Design systems, Prototyping, User-centered design, Accessibility. Trending and emerging requirements include AI-assisted creative workflows, Responsive systems, Inclusive design, Design operations, Motion principles.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Creative Director in Ireland, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Ireland and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Creative Director in Ireland, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Creative%20Director.md)[Salary API](https://jobicy.com/salary-api.md)