[Salaries in Ireland](https://jobicy.com/salaries/ie.md)2026 Salary Report

# Customer Success Director salary in Ireland.

The average salary for Customer Success Director in Ireland is $109,600 per year, according to Jobicy salary data updated 11 Oct 2026. Entry-level positions start around $66,500–$89,800, while experienced professionals earn $133,200–$202,500.
Average compensation has increased 4.2% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 11 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$109,600Estimated annual average$7,307Estimated monthly take-home$34.25–$81.67Hourly equivalent range11 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Customer Success Director role helps customers reach desired outcomes through onboarding, adoption, risk management, and expansion planning. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuse. For Ireland, this report combines salary benchmarks in EUR with modeled assumptions for a 20% tax rate, 20 days of annual leave, and a 80.0 cost-of-living index relative to the United States baseline.

High accuracy1861 recent job listings and community reports shaped this estimateUpdated 11 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$109,600Annual benchmarkJunior$66,500–$89,8000-2 yearsMid-level$88,400–$133,1003-5 yearsSenior$133,200–$202,5006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$7,307Hourly equivalentBased on a standard 40-hour week$34.25–$81.67Potential annual bonusIllustrative 10–15% performance range$10,960–$16,440

### Planning reference

Monthly savings target33% illustrative allocation$3,000Retirement contribution16% illustrative allocation$1,500Housing budgetIllustrative 20% monthly ceilingUp to $1,800Emergency fundThree to six months of gross income$27,400–$54,800

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 20% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Customer Success Director pay in Ireland.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Customer Success Director in Ireland](https://jobicy.com/api/jpgraph/chart.php?junior_min=66500&junior_max=89800&middle_min=88400&middle_max=133100&senior_min=133200&senior_max=202500&average=109600&currency=%24&currency_code=USD&title=Customer%20Success%20Director&country=Ireland)
Salary ranges

Enlarge
![Salary progression by experience for Customer Success Director in Ireland](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=78150&m_avg=110750&s_avg=167850&currency=%24&currency_code=USD&title=Customer%20Success%20Director&country=Ireland)
Experience growthEnlarge
![Illustrative monthly salary allocation for Customer Success Director in Ireland](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1827&savings=2996&retirement=1498&housing=1827&disposable=986&currency=%24&currency_code=USD&title=Customer%20Success%20Director&country=Ireland)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.2% over the displayed period, moving from $105,200 to $109,600.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$109,600$34–$82Sep 2026$103,500$32–$77Aug 2026$107,400$34–$80Jul 2026$109,600$34–$82Jun 2026$110,600$35–$82May 2026$106,400$33–$79Apr 2026$105,900$33–$79Mar 2026$107,100$33–$80Feb 2026$102,500$32–$76Jan 2026$102,200$32–$76Dec 2025$102,900$32–$77Nov 2025$105,200$33–$78Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Cribl logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/65d82c04-221.jpeg) Director, Product Management (Security)Cribl→](https://jobicy.com/jobs/155613-director-product-management-security.md) [![Monzo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5b4c0ec3-221.jpg) Director of Product DesignMonzo→](https://jobicy.com/jobs/155586-director-of-product-design-2.md) [![Monzo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5b4c0ec3-221.jpg) Engineering Director, EUMonzo→](https://jobicy.com/jobs/155587-engineering-director-eu.md) [![Salesloft logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/03/8f0ff4d3ba38b945acfa9bbe11e39be1.jpeg) Enterprise Account DirectorSalesloft→](https://jobicy.com/jobs/153464-enterprise-account-director-2.md) [![Silvus Technologies logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/d530fbe8-221.png) Market Development Executive, United States Air Force & Space ForceSilvus Technologies→](https://jobicy.com/jobs/153426-market-development-executive-united-states-air-force-space-force.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Customer%20Success%20Director.md)Career profile

## Pay drivers and skills for Customer Success Director.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 8+ years in the discipline, including ownership of strategy, people, budgets, or enterprise-level outcomes

### Required skills

Customer communicationTroubleshootingCase managementDe-escalationKnowledge managementProduct understanding

### Education requirements

Relevant higher education or equivalent customer-facing and domain-specific experienceEvidence of clear written communication, structured troubleshooting, sound judgment, and empathetic service

### Training and development

Accessibility and inclusive service trainingKnowledge-base writing workshopsProduct troubleshooting labsDe-escalation practiceQuality calibration sessions

### Core skills

Customer communicationTroubleshootingCase managementDe-escalationKnowledge managementProduct understandingRoot-cause analysisService quality

### Trending and emerging skills

Support operations analyticsOmnichannel supportAI-assisted serviceCustomer health scoringSelf-service designAgent-assist systemsPredictive case routingMultilingual automationProactive support

### Key responsibilities

Own the planning and delivery of work in the Customer Success Director remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuseCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Organization-wide strategy and executive accountabilityMulti-team and budget scopeProduct and troubleshooting complexityCustomer segment and service-level responsibilityEscalation and incident ownershipMultilingual or specialized domain capabilityQuality and knowledge-management impact

### Typical career path

Senior specialist or functional managerCustomer Success DirectorVice President or Head of FunctionExecutive leadership or advisory work

### Work specifics

Remote customer team using documented escalation paths, shared knowledge, quality reviews, and service-level targetsWorks with customers, product, engineering, operations, sales, and success teams to resolve issues and prevent recurrenceFollows documented service coverage and escalation schedules, with live overlap during assigned customer-support hoursZendeskIntercomSlackNotionCRM platformsScreen sharingQuality dashboards

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/ie/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/ie/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/ie/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/ie/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/ie/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/ie/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/ie/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/ie/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/ie/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/ie/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/ie/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/ie/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/ie/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/ie/customer-acquisition-manager.md)[Customer Experience Analyst →](https://jobicy.com/salaries/ie/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/ie/customer-insights-manager.md)Market intelligence

## Hiring context for Customer Success Director in Ireland.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Development of location-independent compensation models based on skills and performance rather than geography

###

Key industries

Software as a ServiceE-commerceFinTechConsumer TechnologyHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Customer Success Director pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$92,30016% lower](https://jobicy.com/salaries/ae/customer-success-director.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$70,40036% lower](https://jobicy.com/salaries/at/customer-success-director.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$123,20012% higher](https://jobicy.com/salaries/au/customer-success-director.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$86,80021% lower](https://jobicy.com/salaries/be/customer-success-director.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$115,4005% higher](https://jobicy.com/salaries/ca/customer-success-director.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$158,70045% higher](https://jobicy.com/salaries/ch/customer-success-director.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$97,50011% lower](https://jobicy.com/salaries/de/customer-success-director.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$57,00048% lower](https://jobicy.com/salaries/es/customer-success-director.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Customer Success Director salary in Ireland?

The estimated average annual salary is $109,600. Junior roles are estimated at $66,500–$89,800, while senior roles are estimated at $133,200–$202,500.

What is the hourly rate for this role?

The estimated hourly equivalent is between $34.25 and $81.67 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Customer communication, Troubleshooting, Case management, De-escalation, Knowledge management. Trending and emerging requirements include Support operations analytics, Omnichannel support, AI-assisted service, Customer health scoring, Self-service design.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Customer Success Director in Ireland, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Ireland and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Customer Success Director in Ireland, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Customer%20Success%20Director.md)[Salary API](https://jobicy.com/salary-api.md)