[Salaries in Ireland](https://jobicy.com/salaries/ie.md)2026 Salary Report

# Database Administrator salary in Ireland.

The Database Administrator role keeps databases available, secure, recoverable, performant, and ready for planned change. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For Ireland, this report combines salary benchmarks in EUR with modeled assumptions for a 20% tax rate, 20 days of annual leave, and a 80.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$90,000Estimated annual average$6,000Estimated monthly take-home$28.13–$67.07Hourly equivalent range1 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1570 recent job listings and community reports shaped this estimateUpdated 1 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$90,000Annual benchmarkJunior$55,400–$71,2000-2 yearsMid-level$71,700–$111,5003-5 yearsSenior$105,000–$158,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$6,000Hourly equivalentBased on a standard 40-hour week$28.13–$67.07Potential annual bonusIllustrative 10–15% performance range$9,000–$13,500

### Planning reference

Monthly savings target27% illustrative allocation$2,000Retirement contribution12% illustrative allocation$900Housing budgetIllustrative 20% monthly ceilingUp to $1,500Emergency fundThree to six months of gross income$22,500–$45,000

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 20% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Database Administrator pay in Ireland.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Database Administrator in Ireland](https://jobicy.com/api/jpgraph/chart.php?junior_min=55400&junior_max=71200&middle_min=71700&middle_max=111500&senior_min=105000&senior_max=158800&average=90000&currency=%24&currency_code=USD&title=Database%20Administrator&country=Ireland)
Salary ranges

Enlarge
![Salary progression by experience for Database Administrator in Ireland](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=63300&m_avg=91600&s_avg=131900&currency=%24&currency_code=USD&title=Database%20Administrator&country=Ireland)
Experience growthEnlarge
![Illustrative monthly salary allocation for Database Administrator in Ireland](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1500&savings=2048&retirement=915&housing=1500&disposable=1538&currency=%24&currency_code=USD&title=Database%20Administrator&country=Ireland)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3.3% over the displayed period, moving from $87,100 to $90,000.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$90,000$28–$67Sep 2026$90,400$28–$67Aug 2026$85,900$27–$64Jul 2026$89,500$28–$67Jun 2026$89,600$28–$67May 2026$84,800$27–$63Apr 2026$83,600$26–$62Mar 2026$84,700$26–$63Feb 2026$82,600$26–$62Jan 2026$85,300$27–$64Dec 2025$86,500$27–$64Nov 2025$87,100$27–$65Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Cordance logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/e9fec3ef-221.png) Data ArchitectCordance→](https://jobicy.com/jobs/152947-data-architect.md) [![WorkWave logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/03/78458cfe50d13ec79a5afc7a7a557272.jpeg) Provisioning SpecialistWorkWave→](https://jobicy.com/jobs/154645-provisioning-specialist.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Database%20Administrator.md)Career profile

## Pay drivers and skills for Database Administrator.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Database administrationBackup and recoveryQuery tuningHigh availabilitySQLData analysis

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Data governance workshopsExperiment design practiceDashboard accessibility reviewsPrivacy-aware analytics trainingAdvanced SQL and query optimization

### Core skills

Database administrationBackup and recoveryQuery tuningHigh availabilitySQLData analysisStatisticsData qualityData modeling

### Trending and emerging skills

Semantic layersSelf-service analyticsModern data stacksAnalytics engineeringData governanceVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Database Administrator remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsData volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experience

### Typical career path

Entry-level or associate role in the disciplineDatabase AdministratorSenior Database AdministratorLead analyst, analytics management, data science, or data-platform leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeTableauPower BIGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/ie/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/ie/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/ie/analytics-implementation-manager.md)[API Integration Specialist →](https://jobicy.com/salaries/ie/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/ie/automation-engineer.md)[Blockchain Analyst →](https://jobicy.com/salaries/ie/blockchain-analyst.md)[Blockchain Developer →](https://jobicy.com/salaries/ie/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/ie/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/ie/blockchain-security-analyst.md)[Business Analyst →](https://jobicy.com/salaries/ie/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/ie/business-intelligence-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/ie/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/ie/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/ie/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/ie/cplusplus-developer.md)[Customer Experience Analyst →](https://jobicy.com/salaries/ie/customer-experience-analyst.md)Market intelligence

## Hiring context for Database Administrator in Ireland.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Enhanced remote training and development programs utilizing interactive online learning platforms

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Database Administrator pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$78,40013% lower](https://jobicy.com/salaries/ae/database-administrator.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$58,90035% lower](https://jobicy.com/salaries/at/database-administrator.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$97,3008% higher](https://jobicy.com/salaries/au/database-administrator.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$67,70025% lower](https://jobicy.com/salaries/be/database-administrator.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$92,2002% higher](https://jobicy.com/salaries/ca/database-administrator.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$129,50044% higher](https://jobicy.com/salaries/ch/database-administrator.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$79,90011% lower](https://jobicy.com/salaries/de/database-administrator.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$49,10045% lower](https://jobicy.com/salaries/es/database-administrator.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Database Administrator salary in Ireland?

The estimated average annual salary is $90,000. Junior roles are estimated at $55,400–$71,200, while senior roles are estimated at $105,000–$158,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $28.13 and $67.07 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Database administration, Backup and recovery, Query tuning, High availability, SQL. Trending and emerging requirements include Semantic layers, Self-service analytics, Modern data stacks, Analytics engineering, Data governance.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Database Administrator in Ireland, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Ireland and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Database Administrator in Ireland, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Database%20Administrator.md)[Salary API](https://jobicy.com/salary-api.md)