[Salaries in Ireland](https://jobicy.com/salaries/ie.md)2026 Salary Report

# Project Manager salary in Ireland.

The Project Manager role plans and governs delivery across scope, schedule, resources, risk, quality, and stakeholder expectations. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as outcome delivery, operational quality, resource efficiency, risk control, stakeholder confidence, and sustainable improvement. For Ireland, this report combines salary benchmarks in EUR with modeled assumptions for a 20% tax rate, 20 days of annual leave, and a 80.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$81,000Estimated annual average$5,400Estimated monthly take-home$25.31–$60.36Hourly equivalent range30 Sep 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1185 recent job listings and community reports shaped this estimateUpdated 30 Sep 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$81,000Annual benchmarkJunior$48,700–$67,3000-2 yearsMid-level$65,200–$98,5003-5 yearsSenior$101,000–$139,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$5,400Hourly equivalentBased on a standard 40-hour week$25.31–$60.36Potential annual bonusIllustrative 10–15% performance range$8,100–$12,150

### Planning reference

Monthly savings target26% illustrative allocation$1,800Retirement contribution11% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,400Emergency fundThree to six months of gross income$20,250–$40,500

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 20% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Project Manager pay in Ireland.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Project Manager in Ireland](https://jobicy.com/api/jpgraph/chart.php?junior_min=48700&junior_max=67300&middle_min=65200&middle_max=98500&senior_min=101000&senior_max=139600&average=81000&currency=%24&currency_code=USD&title=Project%20Manager&country=Ireland)
Salary ranges

Enlarge
![Salary progression by experience for Project Manager in Ireland](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=58000&m_avg=81850&s_avg=120300&currency=%24&currency_code=USD&title=Project%20Manager&country=Ireland)
Experience growthEnlarge
![Illustrative monthly salary allocation for Project Manager in Ireland](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1350&savings=1775&retirement=736&housing=1350&disposable=1539&currency=%24&currency_code=USD&title=Project%20Manager&country=Ireland)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3.2% over the displayed period, moving from $78,500 to $81,000.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$81,000$25–$60Sep 2026$79,400$25–$59Aug 2026$79,900$25–$60Jul 2026$78,300$24–$58Jun 2026$77,900$24–$58May 2026$77,300$24–$58Apr 2026$80,300$25–$60Mar 2026$77,500$24–$58Feb 2026$76,500$24–$57Jan 2026$76,700$24–$57Dec 2025$77,300$24–$58Nov 2025$78,500$25–$58Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior Software Engineer, Data ProductTRM Labs→](https://jobicy.com/jobs/155044-senior-software-engineer-data-product.md) [![Pattern logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/3f426fd3-221.png) Customer Success JuniorPattern→](https://jobicy.com/jobs/155041-customer-success-junior.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior Software Engineer, Backend | Product EngineeringTRM Labs→](https://jobicy.com/jobs/155038-senior-software-engineer-backend-product-engineering.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior / Staff Intelligence Analyst, Environmental CrimesTRM Labs→](https://jobicy.com/jobs/155032-senior-staff-intelligence-analyst-environmental-crimes.md) [![Nebius logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/d90c0566-221.webp) Engineering Manager/Network Team LeadNebius→](https://jobicy.com/jobs/155029-engineering-manager-network-team-lead.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Project%20Manager.md)Career profile

## Pay drivers and skills for Project Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Project planningDependency managementDelivery governanceStatus communicationStrategic planningStakeholder management

### Education requirements

A degree in business, operations, a relevant functional discipline, or equivalent leadership experienceEvidence of planning complex work, aligning stakeholders, managing risk, and improving measurable outcomes

### Training and development

Financial acumen trainingChange-leadership coachingScenario-planning exercisesFacilitation and negotiation practiceRisk-review workshops

### Professional certifications

PMP, PRINCE2, or equivalent when relevant

### Core skills

Project planningDependency managementDelivery governanceStatus communicationStrategic planningStakeholder managementPrioritizationRisk managementBudget awareness

### Trending and emerging skills

Operational analyticsChange managementObjectives and key resultsDistributed operationsPortfolio prioritizationAI-enabled operationsDynamic resource planningDecision intelligenceResilient operating models

### Key responsibilities

Own the planning and delivery of work in the Project Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against outcome delivery, operational quality, resource efficiency, risk control, stakeholder confidence, and sustainable improvementInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipTeam, budget, and portfolio scopeStrategic decision responsibilityOperational complexity and riskCross-functional influenceEvidence of measurable transformation

### Typical career path

Senior individual contributor or team leadProject ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Distributed business team coordinating priorities through documented decisions, measurable plans, and regular operating reviewsAligns leaders, functional specialists, delivery teams, customers, vendors, and external partnersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseAsanaJiraConfluenceNotionMiroSpreadsheetsBI dashboardsSlack

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/ie/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/ie/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/ie/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/ie/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/ie/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/ie/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/ie/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/ie/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/ie/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/ie/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/ie/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/ie/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/ie/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/ie/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/ie/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/ie/customer-success-director.md)Market intelligence

## Hiring context for Project Manager in Ireland.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Implementation of advanced cybersecurity measures and data protection protocols for distributed teams

###

Key industries

Software as a ServiceProfessional ServicesE-commerceFinancial ServicesHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Project Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$71,40012% lower](https://jobicy.com/salaries/ae/project-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$54,50033% lower](https://jobicy.com/salaries/at/project-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$88,3009% higher](https://jobicy.com/salaries/au/project-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$61,50024% lower](https://jobicy.com/salaries/be/project-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$87,0007% higher](https://jobicy.com/salaries/ca/project-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$115,00042% higher](https://jobicy.com/salaries/ch/project-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$74,9008% lower](https://jobicy.com/salaries/de/project-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$44,60045% lower](https://jobicy.com/salaries/es/project-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Project Manager salary in Ireland?

The estimated average annual salary is $81,000. Junior roles are estimated at $48,700–$67,300, while senior roles are estimated at $101,000–$139,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $25.31 and $60.36 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Project planning, Dependency management, Delivery governance, Status communication, Strategic planning. Trending and emerging requirements include Operational analytics, Change management, Objectives and key results, Distributed operations, Portfolio prioritization.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Project Manager in Ireland, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Ireland and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Project Manager in Ireland, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Project%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)