[Salaries in Italy](https://jobicy.com/salaries/it.md)2026 Salary Report

# Digital Product Designer salary in Italy.

The Digital Product Designer role designs end-to-end digital product experiences from discovery through tested interaction and delivery. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarity. For Italy, this report combines salary benchmarks in EUR with modeled assumptions for a 43% tax rate, 20 days of annual leave, and a 65.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$49,200Estimated annual average$2,337Estimated monthly take-home$15.38–$36.66Hourly equivalent range7 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy216 recent job listings and community reports shaped this estimateUpdated 7 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$49,200Annual benchmarkJunior$30,100–$41,2000-2 yearsMid-level$40,000–$60,4003-5 yearsSenior$60,300–$90,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 43% tax rate$2,337Hourly equivalentBased on a standard 40-hour week$15.38–$36.66Potential annual bonusIllustrative 10–15% performance range$4,920–$7,380

### Planning reference

Monthly savings target23% illustrative allocation$900Retirement contribution16% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $800Emergency fundThree to six months of gross income$12,300–$24,600

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 43% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Digital Product Designer pay in Italy.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Digital Product Designer in Italy](https://jobicy.com/api/jpgraph/chart.php?junior_min=30100&junior_max=41200&middle_min=40000&middle_max=60400&senior_min=60300&senior_max=90400&average=49200&currency=%24&currency_code=USD&title=Digital%20Product%20Designer&country=Italy)
Salary ranges

Enlarge
![Salary progression by experience for Digital Product Designer in Italy](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=35650&m_avg=50200&s_avg=75350&currency=%24&currency_code=USD&title=Digital%20Product%20Designer&country=Italy)
Experience growthEnlarge
![Illustrative monthly salary allocation for Digital Product Designer in Italy](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1763&savings=943&retirement=644&housing=820&disposable=0&currency=%24&currency_code=USD&title=Digital%20Product%20Designer&country=Italy)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2.7% over the displayed period, moving from $47,900 to $49,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$49,200$15–$37Sep 2026$49,700$16–$37Aug 2026$49,000$15–$37Jul 2026$49,000$15–$37Jun 2026$47,900$15–$36May 2026$48,400$15–$36Apr 2026$47,700$15–$36Mar 2026$45,400$14–$34Feb 2026$45,200$14–$34Jan 2026$46,300$14–$35Dec 2025$47,000$15–$35Nov 2025$47,900$15–$36Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Synthesia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/c69aad11-221.webp) Senior Brand Designer, ExperientialSynthesia→](https://jobicy.com/jobs/152993-senior-brand-designer-experiential.md) [![Instrument logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/4bad3e7b155943ebf27d1da56ae2e258.jpg) Senior DeveloperInstrument→](https://jobicy.com/jobs/152903-senior-developer.md) [![Instrument logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/04/4bad3e7b155943ebf27d1da56ae2e258.jpg) Freelance Product and Brand Designers – Join Our NetworkInstrument→](https://jobicy.com/jobs/152896-freelance-product-and-brand-designers-join-our-network.md) [![Tremendous logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/01/c2bd8be5-221.jpeg) Senior Product Manager - Prepaid CardsTremendous→](https://jobicy.com/jobs/152853-senior-product-manager-prepaid-cards.md) [![Juniper Square logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/90c359a8bed816e81ea39fa33a8314f3.png) Group Product Manager, AI-Native Data WarehouseJuniper Square→](https://jobicy.com/jobs/154953-group-product-manager-ai-native-data-warehouse.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Digital%20Product%20Designer.md)Career profile

## Pay drivers and skills for Digital Product Designer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Visual communicationDesign systemsPrototypingUser-centered designAccessibilityCritique

### Education requirements

A degree in design, visual communication, interaction design, or an equivalent professional portfolioA portfolio that explains process, constraints, iteration, and measurable outcomes rather than only final visuals

### Training and development

Design-system contribution workshopsResearch synthesis practiceAdvanced prototyping labsAccessibility and inclusive design reviewsFacilitated critique sessions

### Core skills

Visual communicationDesign systemsPrototypingUser-centered designAccessibilityCritiqueInformation hierarchyDesign documentation

### Trending and emerging skills

Responsive systemsInclusive designDesign operationsMotion principlesAI-assisted creative workflowsSpatial interfacesGenerative design systemsMultimodal prototypingReal-time 3D experiences

### Key responsibilities

Own the planning and delivery of work in the Digital Product Designer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarityCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Portfolio quality and demonstrated outcomesProduct or brand complexityResearch and accessibility capabilityDesign-system ownershipAdvanced production-tool expertiseScope of creative direction and stakeholder influence

### Typical career path

Entry-level or associate role in the disciplineDigital Product DesignerSenior Digital Product DesignerLead designer, design systems leadership, creative direction, or design management

### Work specifics

Remote creative team using shared design systems, documented feedback, and frequent prototype reviewsWorks closely with research, product, engineering, content, marketing, and brand stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseProductboardAmplitudeFigmaAdobe Creative CloudMiroNotionPrototyping toolsAsset libraries

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[3D Artist →](https://jobicy.com/salaries/it/3d-artist.md)[Animation Director →](https://jobicy.com/salaries/it/animation-director.md)[AR/VR Designer →](https://jobicy.com/salaries/it/ar-vr-designer.md)[Content Designer →](https://jobicy.com/salaries/it/content-designer.md)[Creative Director →](https://jobicy.com/salaries/it/creative-director.md)[Data Visualization Specialist →](https://jobicy.com/salaries/it/data-visualization-specialist.md)[Instructional Designer →](https://jobicy.com/salaries/it/instructional-designer.md)[Learning Experience Designer →](https://jobicy.com/salaries/it/learning-experience-designer.md)[Motion Designer →](https://jobicy.com/salaries/it/motion-designer.md)[Multimedia Producer →](https://jobicy.com/salaries/it/multimedia-producer.md)[Podcast Producer →](https://jobicy.com/salaries/it/podcast-producer.md)[Service Design Manager →](https://jobicy.com/salaries/it/service-design-manager.md)[Social Content Producer →](https://jobicy.com/salaries/it/social-content-producer.md)[User Research Manager →](https://jobicy.com/salaries/it/user-research-manager.md)[UX Designer →](https://jobicy.com/salaries/it/ux-designer.md)[Video Editor →](https://jobicy.com/salaries/it/video-editor.md)Market intelligence

## Hiring context for Digital Product Designer in Italy.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Integration of virtual reality and augmented reality tools for remote collaboration and training

###

Key industries

Software as a ServiceE-commerceMedia and EntertainmentConsumer TechnologyGamingDigital AgenciesCross-country pay scale

## Compare Digital Product Designer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$71,60046% higher](https://jobicy.com/salaries/ae/digital-product-designer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$54,80011% higher](https://jobicy.com/salaries/at/digital-product-designer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$91,70086% higher](https://jobicy.com/salaries/au/digital-product-designer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$67,40037% higher](https://jobicy.com/salaries/be/digital-product-designer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$89,70082% higher](https://jobicy.com/salaries/ca/digital-product-designer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$118,700141% higher](https://jobicy.com/salaries/ch/digital-product-designer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$78,90060% higher](https://jobicy.com/salaries/de/digital-product-designer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$47,0004% lower](https://jobicy.com/salaries/es/digital-product-designer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Digital Product Designer salary in Italy?

The estimated average annual salary is $49,200. Junior roles are estimated at $30,100–$41,200, while senior roles are estimated at $60,300–$90,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $15.38 and $36.66 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Visual communication, Design systems, Prototyping, User-centered design, Accessibility. Trending and emerging requirements include Responsive systems, Inclusive design, Design operations, Motion principles, AI-assisted creative workflows.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Digital Product Designer in Italy, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Italy and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Digital Product Designer in Italy, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Digital%20Product%20Designer.md)[Salary API](https://jobicy.com/salary-api.md)