[Salaries in Japan](https://jobicy.com/salaries/jp.md)2026 Salary Report

# Product Analytics Manager salary in Japan.

The average salary for Product Analytics Manager in Japan is $62,500 per year, according to Jobicy salary data updated 8 Oct 2026. Entry-level positions start around $38,100–$51,600, while experienced professionals earn $75,300–$115,400.
Average compensation has increased 4.7% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 8 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$62,500Estimated annual average$3,646Estimated monthly take-home$19.53–$46.57Hourly equivalent range8 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

In a remote organization, a Product Analytics Manager builds the measurement and experimentation system used to understand product behavior and guide decisions. The position rewards independent ownership, documented reasoning, and continuous improvement across accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For Japan, this report combines salary benchmarks in JPY with modeled assumptions for a 30% tax rate, 10 days of annual leave, and a 72.0 cost-of-living index relative to the United States baseline.

Reliable accuracy287 recent job listings and community reports shaped this estimateUpdated 8 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$62,500Annual benchmarkJunior$38,100–$51,6000-2 yearsMid-level$48,900–$77,6003-5 yearsSenior$75,300–$115,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 30% tax rate$3,646Hourly equivalentBased on a standard 40-hour week$19.53–$46.57Potential annual bonusIllustrative 10–15% performance range$6,250–$9,375

### Planning reference

Monthly savings target34% illustrative allocation$1,800Retirement contribution13% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,000Emergency fundThree to six months of gross income$15,625–$31,250

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 30% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Product Analytics Manager pay in Japan.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Product Analytics Manager in Japan](https://jobicy.com/api/jpgraph/chart.php?junior_min=38100&junior_max=51600&middle_min=48900&middle_max=77600&senior_min=75300&senior_max=115400&average=62500&currency=%24&currency_code=USD&title=Product%20Analytics%20Manager&country=Japan)
Salary ranges

Enlarge
![Salary progression by experience for Product Analytics Manager in Japan](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=44850&m_avg=63250&s_avg=95350&currency=%24&currency_code=USD&title=Product%20Analytics%20Manager&country=Japan)
Experience growthEnlarge
![Illustrative monthly salary allocation for Product Analytics Manager in Japan](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1563&savings=1755&retirement=698&housing=1042&disposable=151&currency=%24&currency_code=USD&title=Product%20Analytics%20Manager&country=Japan)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.7% over the displayed period, moving from $59,700 to $62,500.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$62,500$20–$47Sep 2026$59,000$18–$44Aug 2026$59,900$19–$45Jul 2026$61,600$19–$46Jun 2026$59,600$19–$44May 2026$58,400$18–$44Apr 2026$62,000$19–$46Mar 2026$58,400$18–$44Feb 2026$59,700$19–$44Jan 2026$58,500$18–$44Dec 2025$59,700$19–$44Nov 2025$59,700$19–$44Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![TE Connectivity logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/07/44e3e9132b6f-221.webp) ANALYST DIGITAL MARKETING IV (Remote) IVTE Connectivity→](https://jobicy.com/jobs/150674-analyst-digital-marketing-iv-remote-iv.md) [![Quantum Metric logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/52363ead-221.jpg) Solutions Engineer - USQuantum Metric→](https://jobicy.com/jobs/153333-solutions-engineer-us.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) Engineering Manager - EUAshby→](https://jobicy.com/jobs/150687-engineering-manager-eu.md) [![Meta logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/750f86a9-221.jpeg) Data Engineer, Product AnalyticsMeta→](https://jobicy.com/jobs/150666-data-engineer-product-analytics.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) Mid Market Account Executive - EMEA (French Speaking)Ashby→](https://jobicy.com/jobs/150688-mid-market-account-executive-emea-french-speaking.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Product%20Analytics%20Manager.md)Career profile

## Pay drivers and skills for Product Analytics Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Metric designDashboardingCohort analysisStakeholder synthesisSQLData analysis

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Dashboard accessibility reviewsPrivacy-aware analytics trainingAdvanced SQL and query optimizationData governance workshopsExperiment design practice

### Core skills

Metric designDashboardingCohort analysisStakeholder synthesisSQLData analysisStatisticsData qualityData modeling

### Trending and emerging skills

Data governanceSemantic layersSelf-service analyticsModern data stacksAnalytics engineeringVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Product Analytics Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipData volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experience

### Typical career path

Senior individual contributor or team leadProduct Analytics ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseProductboardAmplitudeFigmaSQLPythondbtTableauPower BI

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/jp/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/jp/affiliate-program-manager.md)[AI Engineer →](https://jobicy.com/salaries/jp/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/jp/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/jp/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/jp/animation-director.md)[Blockchain Analyst →](https://jobicy.com/salaries/jp/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/jp/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/jp/business-development-manager.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/jp/business-intelligence-analyst.md)[Change Management Consultant →](https://jobicy.com/salaries/jp/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/jp/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/jp/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/jp/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/jp/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/jp/conversion-optimization-manager.md)Market intelligence

## Hiring context for Product Analytics Manager in Japan.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Evolution of remote collaboration practices incorporating AI-powered productivity tools and virtual reality meetings

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Product Analytics Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$87,40040% higher](https://jobicy.com/salaries/ae/product-analytics-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$68,60010% higher](https://jobicy.com/salaries/at/product-analytics-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$112,10079% higher](https://jobicy.com/salaries/au/product-analytics-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$77,70024% higher](https://jobicy.com/salaries/be/product-analytics-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$108,60074% higher](https://jobicy.com/salaries/ca/product-analytics-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$148,900138% higher](https://jobicy.com/salaries/ch/product-analytics-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$90,10044% higher](https://jobicy.com/salaries/de/product-analytics-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$55,50011% lower](https://jobicy.com/salaries/es/product-analytics-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Product Analytics Manager salary in Japan?

The estimated average annual salary is $62,500. Junior roles are estimated at $38,100–$51,600, while senior roles are estimated at $75,300–$115,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $19.53 and $46.57 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Metric design, Dashboarding, Cohort analysis, Stakeholder synthesis, SQL. Trending and emerging requirements include Data governance, Semantic layers, Self-service analytics, Modern data stacks, Analytics engineering.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Product Analytics Manager in Japan, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Japan and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Product Analytics Manager in Japan, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Product%20Analytics%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)