[Salaries in Japan](https://jobicy.com/salaries/jp.md)2026 Salary Report

# Sales Manager salary in Japan.

The average salary for Sales Manager in Japan is $47,200 per year, according to Jobicy salary data updated 3 Oct 2026. Entry-level positions start around $28,300–$37,900, while experienced professionals earn $56,600–$89,600.
Average compensation has increased 1.7% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 3 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$47,200Estimated annual average$2,753Estimated monthly take-home$14.75–$35.17Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Sales Manager role coaches a sales team and runs pipeline, forecasts, performance, hiring, and deal strategy. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as revenue, win rate, pipeline coverage, forecast accuracy, deal quality, and customer fit. For Japan, this report combines salary benchmarks in JPY with modeled assumptions for a 30% tax rate, 10 days of annual leave, and a 72.0 cost-of-living index relative to the United States baseline.

Reliable accuracy293 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$47,200Annual benchmarkJunior$28,300–$37,9000-2 yearsMid-level$38,300–$58,2003-5 yearsSenior$56,600–$89,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 30% tax rate$2,753Hourly equivalentBased on a standard 40-hour week$14.75–$35.17Potential annual bonusIllustrative 10–15% performance range$4,720–$7,080

### Planning reference

Monthly savings target23% illustrative allocation$900Retirement contribution17% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $800Emergency fundThree to six months of gross income$11,800–$23,600

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 30% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Sales Manager pay in Japan.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Sales Manager in Japan](https://jobicy.com/api/jpgraph/chart.php?junior_min=28300&junior_max=37900&middle_min=38300&middle_max=58200&senior_min=56600&senior_max=89600&average=47200&currency=%24&currency_code=USD&title=Sales%20Manager&country=Japan)
Salary ranges

Enlarge
![Salary progression by experience for Sales Manager in Japan](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=33100&m_avg=48250&s_avg=73100&currency=%24&currency_code=USD&title=Sales%20Manager&country=Japan)
Experience growthEnlarge
![Illustrative monthly salary allocation for Sales Manager in Japan](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1180&savings=889&retirement=649&housing=787&disposable=429&currency=%24&currency_code=USD&title=Sales%20Manager&country=Japan)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1.7% over the displayed period, moving from $46,400 to $47,200.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$47,200$15–$35Sep 2026$50,000$16–$37Aug 2026$50,100$16–$37Jul 2026$48,700$15–$36Jun 2026$47,100$15–$35May 2026$49,800$16–$37Apr 2026$49,700$16–$37Mar 2026$47,100$15–$35Feb 2026$48,000$15–$36Jan 2026$48,700$15–$36Dec 2025$47,500$15–$35Nov 2025$46,400$15–$35Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Algolia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201202014849-982609.jpg) Business Development Representative - Dutch SpeakerAlgolia→](https://jobicy.com/jobs/155217-business-development-representative-dutch-speaker.md) [![Algolia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201202014849-982609.jpg) Business Development RepresentativeAlgolia→](https://jobicy.com/jobs/155215-business-development-representative-17.md) [![Algolia logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201202014849-982609.jpg) Account Manager - Dutch speakingAlgolia→](https://jobicy.com/jobs/155208-account-manager-dutch-speaking.md) [![CoderPad logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/02/57995875e79f20bb0cd2cadad1b52775.jpeg) Strategic Account ExecutiveCoderPad→](https://jobicy.com/jobs/155197-strategic-account-executive-13.md) [![Acceleration Partners logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/44be3675-221.png) Partner Growth Manager (LATAM)Acceleration Partners→](https://jobicy.com/jobs/155188-partner-growth-manager-latam.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Sales%20Manager.md)Career profile

## Pay drivers and skills for Sales Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

DiscoveryPipeline managementNegotiationForecastingConsultative sellingAccount planning

### Education requirements

A degree in business, communications, or equivalent evidence of consultative selling experienceDemonstrated ability to qualify opportunities, understand customer economics, and manage a disciplined sales process

### Training and development

Discovery-call coachingNegotiation simulationsProduct and industry certificationForecast accuracy reviewsAccount-planning workshops

### Core skills

DiscoveryPipeline managementNegotiationForecastingConsultative sellingAccount planningCRM disciplineCommercial communication

### Trending and emerging skills

Intent dataDigital sales roomsAI-assisted prospect researchRevenue intelligenceProduct-led salesBuyer-signal orchestrationConversation intelligenceUsage-based commercial modelsAutomated account research

### Key responsibilities

Own the planning and delivery of work in the Sales Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against revenue, win rate, pipeline coverage, forecast accuracy, deal quality, and customer fitInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Variable compensation structureQuota size and enterprise account responsibilityTeam size and people-management responsibilityBudget and portfolio ownershipQuota and revenue responsibilityAverage deal size and sales-cycle complexityTerritory and account quality

### Typical career path

Senior individual contributor or team leadSales ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote commercial team with defined territories, CRM-based workflows, regular deal reviews, and measurable pipeline stagesCoordinates with marketing, solutions, product, finance, legal, and customer success throughout the buying journeyRequires dependable overlap with assigned customer territories for discovery, demonstrations, negotiation, and deal coordinationSalesforceHubSpotLinkedIn Sales NavigatorZoomGongProposal softwareForecasting tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/jp/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/jp/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/jp/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/jp/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/jp/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/jp/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/jp/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/jp/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/jp/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/jp/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/jp/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/jp/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/jp/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/jp/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/jp/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/jp/customer-success-director.md)Market intelligence

## Hiring context for Sales Manager in Japan.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Integration of virtual reality and augmented reality tools for remote collaboration and training

###

Key industries

Software as a ServiceCloud ComputingFinTechCybersecurityBusiness ServicesData PlatformsCross-country pay scale

## Compare Sales Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$69,40047% higher](https://jobicy.com/salaries/ae/sales-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$54,40015% higher](https://jobicy.com/salaries/at/sales-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$88,00086% higher](https://jobicy.com/salaries/au/sales-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$64,30036% higher](https://jobicy.com/salaries/be/sales-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$83,80078% higher](https://jobicy.com/salaries/ca/sales-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$115,900146% higher](https://jobicy.com/salaries/ch/sales-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$71,10051% higher](https://jobicy.com/salaries/de/sales-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$44,5006% lower](https://jobicy.com/salaries/es/sales-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Sales Manager salary in Japan?

The estimated average annual salary is $47,200. Junior roles are estimated at $28,300–$37,900, while senior roles are estimated at $56,600–$89,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $14.75 and $35.17 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Discovery, Pipeline management, Negotiation, Forecasting, Consultative selling. Trending and emerging requirements include Intent data, Digital sales rooms, AI-assisted prospect research, Revenue intelligence, Product-led sales.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Sales Manager in Japan, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Japan and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Sales Manager in Japan, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Sales%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)