[Salaries in Japan](https://jobicy.com/salaries/jp.md)2026 Salary Report

# Technical Support Manager salary in Japan.

The average salary for Technical Support Manager in Japan is $50,100 per year, according to Jobicy salary data updated 4 Oct 2026. Entry-level positions start around $30,000–$39,800, while experienced professionals earn $62,600–$88,400.
Average compensation has increased 2.7% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 4 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$50,100Estimated annual average$2,923Estimated monthly take-home$15.66–$37.33Hourly equivalent range4 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

A Technical Support Manager leads technical support operations across staffing, quality, escalations, tooling, and product feedback. The work combines subject-matter judgment with disciplined execution and is commonly assessed through resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuse. For Japan, this report combines salary benchmarks in JPY with modeled assumptions for a 30% tax rate, 10 days of annual leave, and a 72.0 cost-of-living index relative to the United States baseline.

Reliable accuracy102 recent job listings and community reports shaped this estimateUpdated 4 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$50,100Annual benchmarkJunior$30,000–$39,8000-2 yearsMid-level$40,800–$59,3003-5 yearsSenior$62,600–$88,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 30% tax rate$2,923Hourly equivalentBased on a standard 40-hour week$15.66–$37.33Potential annual bonusIllustrative 10–15% performance range$5,010–$7,515

### Planning reference

Monthly savings target33% illustrative allocation$1,400Retirement contribution16% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $800Emergency fundThree to six months of gross income$12,525–$25,050

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 30% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Technical Support Manager pay in Japan.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Technical Support Manager in Japan](https://jobicy.com/api/jpgraph/chart.php?junior_min=30000&junior_max=39800&middle_min=40800&middle_max=59300&senior_min=62600&senior_max=88400&average=50100&currency=%24&currency_code=USD&title=Technical%20Support%20Manager&country=Japan)
Salary ranges

Enlarge
![Salary progression by experience for Technical Support Manager in Japan](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=34900&m_avg=50050&s_avg=75500&currency=%24&currency_code=USD&title=Technical%20Support%20Manager&country=Japan)
Experience growthEnlarge
![Illustrative monthly salary allocation for Technical Support Manager in Japan](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1253&savings=1374&retirement=685&housing=835&disposable=29&currency=%24&currency_code=USD&title=Technical%20Support%20Manager&country=Japan)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2.7% over the displayed period, moving from $48,800 to $50,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$50,100$16–$37Sep 2026$52,400$16–$39Aug 2026$49,700$16–$37Jul 2026$51,000$16–$38Jun 2026$49,100$15–$37May 2026$51,800$16–$39Apr 2026$50,900$16–$38Mar 2026$48,200$15–$36Feb 2026$48,600$15–$36Jan 2026$50,600$16–$38Dec 2025$48,600$15–$36Nov 2025$48,800$15–$36Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![CertiK logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210308091023-955845.jpg) Lead Product Manager, Digital AssetsCertiK→](https://jobicy.com/jobs/155441-lead-product-manager-digital-assets.md) [![Apaleo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/6d684c9f-221.png) Sales Solutions Manager (f/m/d)Apaleo→](https://jobicy.com/jobs/155445-sales-solutions-manager-f-m-d.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) Strategic Customer Success Manager - EMEAAshby→](https://jobicy.com/jobs/155426-strategic-customer-success-manager-emea.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) GTM Systems AnalystAshby→](https://jobicy.com/jobs/155421-gtm-systems-analyst.md) [![GitLab logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201207055737-109952.jpg) Associate Renewals ManagerGitLab→](https://jobicy.com/jobs/155427-associate-renewals-manager.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Technical%20Support%20Manager.md)Career profile

## Pay drivers and skills for Technical Support Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Technical troubleshootingCase ownershipEscalation managementKnowledge writingCustomer communicationTroubleshooting

### Education requirements

Relevant higher education or equivalent customer-facing and domain-specific experienceEvidence of clear written communication, structured troubleshooting, sound judgment, and empathetic service

### Training and development

Product troubleshooting labsDe-escalation practiceQuality calibration sessionsAccessibility and inclusive service trainingKnowledge-base writing workshops

### Core skills

Technical troubleshootingCase ownershipEscalation managementKnowledge writingCustomer communicationTroubleshootingCase managementDe-escalationKnowledge management

### Trending and emerging skills

Omnichannel supportAI-assisted serviceCustomer health scoringSelf-service designSupport operations analyticsAgent-assist systemsPredictive case routingMultilingual automationProactive support

### Key responsibilities

Own the planning and delivery of work in the Technical Support Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against resolution quality, response time, customer effort, satisfaction, recurrence, and knowledge reuseCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipProduct and troubleshooting complexityCustomer segment and service-level responsibilityEscalation and incident ownershipMultilingual or specialized domain capabilityQuality and knowledge-management impact

### Typical career path

Senior individual contributor or team leadTechnical Support ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote customer team using documented escalation paths, shared knowledge, quality reviews, and service-level targetsWorks with customers, product, engineering, operations, sales, and success teams to resolve issues and prevent recurrenceFollows documented service coverage and escalation schedules, with live overlap during assigned customer-support hoursZendeskIntercomJira Service ManagementSlackNotionCRM platformsScreen sharingQuality dashboards

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/jp/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/jp/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/jp/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/jp/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/jp/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/jp/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/jp/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/jp/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/jp/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/jp/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/jp/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/jp/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/jp/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/jp/customer-acquisition-manager.md)[Customer Experience Analyst →](https://jobicy.com/salaries/jp/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/jp/customer-insights-manager.md)Market intelligence

## Hiring context for Technical Support Manager in Japan.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Adoption of sophisticated project management tools and productivity tracking systems for remote teams

###

Key industries

Software as a ServiceE-commerceFinTechConsumer TechnologyHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Technical Support Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$75,70051% higher](https://jobicy.com/salaries/ae/technical-support-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$56,30012% higher](https://jobicy.com/salaries/at/technical-support-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$93,00086% higher](https://jobicy.com/salaries/au/technical-support-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$64,40029% higher](https://jobicy.com/salaries/be/technical-support-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$90,50081% higher](https://jobicy.com/salaries/ca/technical-support-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$124,700149% higher](https://jobicy.com/salaries/ch/technical-support-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$77,20054% higher](https://jobicy.com/salaries/de/technical-support-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$46,3008% lower](https://jobicy.com/salaries/es/technical-support-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Technical Support Manager salary in Japan?

The estimated average annual salary is $50,100. Junior roles are estimated at $30,000–$39,800, while senior roles are estimated at $62,600–$88,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $15.66 and $37.33 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Technical troubleshooting, Case ownership, Escalation management, Knowledge writing, Customer communication. Trending and emerging requirements include Omnichannel support, AI-assisted service, Customer health scoring, Self-service design, Support operations analytics.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Technical Support Manager in Japan, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Japan and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Technical Support Manager in Japan, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Technical%20Support%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)