[Salaries in Japan](https://jobicy.com/salaries/jp.md)2026 Salary Report

# User Research Manager salary in Japan.

A successful User Research Manager leads ethical research that explains user behavior and gives product teams actionable evidence. Rather than measuring activity alone, organizations usually evaluate the role through decision influence, research quality, participant diversity, time to insight, evidence reuse, and reduction of product uncertainty. For Japan, this report combines salary benchmarks in JPY with modeled assumptions for a 30% tax rate, 10 days of annual leave, and a 72.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$54,900Estimated annual average$3,203Estimated monthly take-home$17.16–$40.91Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy150 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$54,900Annual benchmarkJunior$33,000–$45,2000-2 yearsMid-level$44,600–$65,6003-5 yearsSenior$68,000–$99,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 30% tax rate$3,203Hourly equivalentBased on a standard 40-hour week$17.16–$40.91Potential annual bonusIllustrative 10–15% performance range$5,490–$8,235

### Planning reference

Monthly savings target31% illustrative allocation$1,400Retirement contribution11% illustrative allocation$500Housing budgetIllustrative 20% monthly ceilingUp to $900Emergency fundThree to six months of gross income$13,725–$27,450

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 30% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to User Research Manager pay in Japan.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for User Research Manager in Japan](https://jobicy.com/api/jpgraph/chart.php?junior_min=33000&junior_max=45200&middle_min=44600&middle_max=65600&senior_min=68000&senior_max=99300&average=54900&currency=%24&currency_code=USD&title=User%20Research%20Manager&country=Japan)
Salary ranges

Enlarge
![Salary progression by experience for User Research Manager in Japan](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=39100&m_avg=55100&s_avg=83650&currency=%24&currency_code=USD&title=User%20Research%20Manager&country=Japan)
Experience growthEnlarge
![Illustrative monthly salary allocation for User Research Manager in Japan](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1373&savings=1427&retirement=522&housing=915&disposable=339&currency=%24&currency_code=USD&title=User%20Research%20Manager&country=Japan)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 5.4% over the displayed period, moving from $52,100 to $54,900.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$54,900$17–$41Sep 2026$51,900$16–$39Aug 2026$52,200$16–$39Jul 2026$54,200$17–$40Jun 2026$55,000$17–$41May 2026$51,700$16–$39Apr 2026$54,000$17–$40Mar 2026$53,700$17–$40Feb 2026$50,700$16–$38Jan 2026$51,100$16–$38Dec 2025$53,500$17–$40Nov 2025$52,100$16–$39Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Playson logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/6f266d9c-221-1.png) Content ManagerPlayson→](https://jobicy.com/jobs/155156-content-manager.md) [![Smartsheet logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/8b6103bd-221.jpg) Senior Product Manager II, Developer ecosystem MCP (Remote from UK)Smartsheet→](https://jobicy.com/jobs/155065-senior-product-manager-ii-developer-ecosystem-mcp-remote-from-uk.md) [![Kinsta logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/56d3a520-221.jpeg) Senior Product DesignerKinsta→](https://jobicy.com/jobs/153063-senior-product-designer-11.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) Staff Platform Engineer - UKAshby→](https://jobicy.com/jobs/153062-staff-platform-engineer-uk.md) [![Binance logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/bc822f38-221.jpg) Binance Accelerator Program - Enterprise Wide Risk Assessment (EWRA)Binance→](https://jobicy.com/jobs/153024-binance-accelerator-program-enterprise-wide-risk-assessment-ewra.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=User%20Research%20Manager.md)Career profile

## Pay drivers and skills for User Research Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Research planningInterviewingUsability testingSurvey designQualitative analysisResearch ethics

### Education requirements

A degree in human-computer interaction, psychology, anthropology, sociology, design research, or equivalent applied research experienceA portfolio demonstrating ethical study design, recruitment, fieldwork, synthesis, and influence on real decisions

### Training and development

Research ethics and consent refreshersAdvanced interviewing practiceAccessibility research workshopsQuantitative methods for researchersFacilitation and insight storytelling

### Core skills

Research planningInterviewingUsability testingSurvey designQualitative analysisResearch ethicsInsight synthesisStakeholder facilitation

### Trending and emerging skills

Inclusive recruitmentRepository governanceContinuous discoveryResearch operationsMixed-methods researchAI-assisted synthesis with human validationUnmoderated longitudinal researchPrivacy-preserving research operationsSynthetic-user limitations analysis

### Key responsibilities

Own the planning and delivery of work in the User Research Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against decision influence, research quality, participant diversity, time to insight, evidence reuse, and reduction of product uncertaintyCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipResearch-method depthComplexity and sensitivity of the study domainInfluence on product strategyResearch operations and team leadershipMixed-methods capability

### Typical career path

Senior individual contributor or team leadUser Research ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote research practice with informed consent, secure recordings, inclusive recruitment, transparent analysis, and a governed insight repositoryWorks with participants, design, product, analytics, engineering, marketing, support, and leadership while protecting research independenceUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseDovetailUserTestingFigmaMiroSurvey platformsVideo conferencingResearch repositories

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[3D Artist →](https://jobicy.com/salaries/jp/3d-artist.md)[Account Based Marketing Manager →](https://jobicy.com/salaries/jp/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/jp/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/jp/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/jp/animation-director.md)[AR/VR Designer →](https://jobicy.com/salaries/jp/ar-vr-designer.md)[Business Analyst →](https://jobicy.com/salaries/jp/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/jp/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/jp/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/jp/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/jp/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/jp/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/jp/content-designer.md)[Content Quality Manager →](https://jobicy.com/salaries/jp/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/jp/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/jp/creative-director.md)Market intelligence

## Hiring context for User Research Manager in Japan.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Development of location-independent compensation models based on skills and performance rather than geography

###

Key industries

Software as a ServiceConsumer TechnologyE-commerceFinancial ServicesHealthcare TechnologyResearch ServicesCross-country pay scale

## Compare User Research Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$77,00040% higher](https://jobicy.com/salaries/ae/user-research-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$58,9007% higher](https://jobicy.com/salaries/at/user-research-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$97,10077% higher](https://jobicy.com/salaries/au/user-research-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$68,10024% higher](https://jobicy.com/salaries/be/user-research-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$94,00071% higher](https://jobicy.com/salaries/ca/user-research-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$122,500123% higher](https://jobicy.com/salaries/ch/user-research-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$82,00049% higher](https://jobicy.com/salaries/de/user-research-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$48,40012% lower](https://jobicy.com/salaries/es/user-research-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average User Research Manager salary in Japan?

The estimated average annual salary is $54,900. Junior roles are estimated at $33,000–$45,200, while senior roles are estimated at $68,000–$99,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $17.16 and $40.91 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Research planning, Interviewing, Usability testing, Survey design, Qualitative analysis. Trending and emerging requirements include Inclusive recruitment, Repository governance, Continuous discovery, Research operations, Mixed-methods research.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for User Research Manager in Japan, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Japan and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for User Research Manager in Japan, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=User%20Research%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)