[Salaries in New Zealand](https://jobicy.com/salaries/nz.md)2026 Salary Report

# Animation Director salary in New Zealand.

The core purpose of an Animation Director is practical: the professional sets the visual motion language and production standards for animated stories, products, and campaigns. Day-to-day priorities vary by company, but performance is generally visible in usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarity. For New Zealand, this report combines salary benchmarks in NZD with modeled assumptions for a 33% tax rate, 20 days of annual leave, and a 78.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$82,700Estimated annual average$4,617Estimated monthly take-home$25.84–$61.63Hourly equivalent range4 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy777 recent job listings and community reports shaped this estimateUpdated 4 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$82,700Annual benchmarkJunior$49,500–$67,1000-2 yearsMid-level$66,700–$98,4003-5 yearsSenior$97,300–$148,1006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 33% tax rate$4,617Hourly equivalentBased on a standard 40-hour week$25.84–$61.63Potential annual bonusIllustrative 10–15% performance range$8,270–$12,405

### Planning reference

Monthly savings target26% illustrative allocation$1,800Retirement contribution17% illustrative allocation$1,100Housing budgetIllustrative 20% monthly ceilingUp to $1,400Emergency fundThree to six months of gross income$20,675–$41,350

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 33% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Animation Director pay in New Zealand.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Animation Director in New Zealand](https://jobicy.com/api/jpgraph/chart.php?junior_min=49500&junior_max=67100&middle_min=66700&middle_max=98400&senior_min=97300&senior_max=148100&average=82700&currency=%24&currency_code=USD&title=Animation%20Director&country=New%20Zealand)
Salary ranges

Enlarge
![Salary progression by experience for Animation Director in New Zealand](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=58300&m_avg=82550&s_avg=122700&currency=%24&currency_code=USD&title=Animation%20Director&country=New%20Zealand)
Experience growthEnlarge
![Illustrative monthly salary allocation for Animation Director in New Zealand](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2274&savings=1819&retirement=1144&housing=1378&disposable=276&currency=%24&currency_code=USD&title=Animation%20Director&country=New%20Zealand)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 4.4% over the displayed period, moving from $79,200 to $82,700.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$82,700$26–$62Sep 2026$80,600$25–$60Aug 2026$80,500$25–$60Jul 2026$80,200$25–$60Jun 2026$78,500$25–$58May 2026$77,300$24–$58Apr 2026$78,500$25–$58Mar 2026$79,500$25–$59Feb 2026$79,000$25–$59Jan 2026$76,300$24–$57Dec 2025$78,100$24–$58Nov 2025$79,200$25–$59Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Wpromote logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/08/e1003ec6a2d34525775d0bc7912ced79.jpg) Digital & Motion DesignerWpromote→](https://jobicy.com/jobs/154789-digital-motion-designer-2.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Animation%20Director.md)Career profile

## Pay drivers and skills for Animation Director.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 8+ years in the discipline, including ownership of strategy, people, budgets, or enterprise-level outcomes

### Required skills

Animation directionStoryboardingTimingProduction pipelinesVisual communicationDesign systems

### Education requirements

A degree in design, visual communication, interaction design, or an equivalent professional portfolioA portfolio that explains process, constraints, iteration, and measurable outcomes rather than only final visuals

### Training and development

Accessibility and inclusive design reviewsFacilitated critique sessionsDesign-system contribution workshopsResearch synthesis practiceAdvanced prototyping labs

### Core skills

Animation directionStoryboardingTimingProduction pipelinesVisual communicationDesign systemsPrototypingUser-centered designAccessibility

### Trending and emerging skills

Motion principlesAI-assisted creative workflowsResponsive systemsInclusive designDesign operationsSpatial interfacesGenerative design systemsMultimodal prototypingReal-time 3D experiences

### Key responsibilities

Own the planning and delivery of work in the Animation Director remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarityInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Organization-wide strategy and executive accountabilityMulti-team and budget scopePortfolio quality and demonstrated outcomesProduct or brand complexityResearch and accessibility capabilityDesign-system ownershipAdvanced production-tool expertise

### Typical career path

Senior specialist or functional managerAnimation DirectorVice President or Head of FunctionExecutive leadership or advisory work

### Work specifics

Remote creative team using shared design systems, documented feedback, and frequent prototype reviewsWorks closely with research, product, engineering, content, marketing, and brand stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseAfter EffectsCinema 4DBlenderFigmaAdobe Creative CloudMiroNotionPrototyping tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[3D Artist →](https://jobicy.com/salaries/nz/3d-artist.md)[Account Based Marketing Manager →](https://jobicy.com/salaries/nz/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/nz/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/nz/analytics-implementation-manager.md)[AR/VR Designer →](https://jobicy.com/salaries/nz/ar-vr-designer.md)[Business Analyst →](https://jobicy.com/salaries/nz/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/nz/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/nz/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/nz/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/nz/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/nz/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/nz/content-designer.md)[Content Quality Manager →](https://jobicy.com/salaries/nz/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/nz/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/nz/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/nz/customer-acquisition-manager.md)Market intelligence

## Hiring context for Animation Director in New Zealand.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Development of location-independent compensation models based on skills and performance rather than geography

###

Key industries

AnimationGamingMedia and EntertainmentAdvertisingCross-country pay scale

## Compare Animation Director pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$89,6008% higher](https://jobicy.com/salaries/ae/animation-director.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$68,80017% lower](https://jobicy.com/salaries/at/animation-director.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$110,10033% higher](https://jobicy.com/salaries/au/animation-director.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$79,3004% lower](https://jobicy.com/salaries/be/animation-director.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$110,60034% higher](https://jobicy.com/salaries/ca/animation-director.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$143,90074% higher](https://jobicy.com/salaries/ch/animation-director.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$92,30012% higher](https://jobicy.com/salaries/de/animation-director.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$53,30036% lower](https://jobicy.com/salaries/es/animation-director.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Animation Director salary in New Zealand?

The estimated average annual salary is $82,700. Junior roles are estimated at $49,500–$67,100, while senior roles are estimated at $97,300–$148,100.

What is the hourly rate for this role?

The estimated hourly equivalent is between $25.84 and $61.63 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Animation direction, Storyboarding, Timing, Production pipelines, Visual communication. Trending and emerging requirements include Motion principles, AI-assisted creative workflows, Responsive systems, Inclusive design, Design operations.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Animation Director in New Zealand, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for New Zealand and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Animation Director in New Zealand, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Animation%20Director.md)[Salary API](https://jobicy.com/salary-api.md)