[Salaries in New Zealand](https://jobicy.com/salaries/nz.md)2026 Salary Report

# Blockchain Analyst salary in New Zealand.

The average salary for Blockchain Analyst in New Zealand is $66,100 per year, according to Jobicy salary data updated 4 Oct 2026. Entry-level positions start around $41,600–$51,400, while experienced professionals earn $80,700–$125,500.
Average compensation has increased 3% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 4 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$66,100Estimated annual average$3,691Estimated monthly take-home$20.66–$49.26Hourly equivalent range4 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

In a remote organization, a Blockchain Analyst interprets on-chain activity, protocol mechanics, market structure, and wallet behavior for decisions. The position rewards independent ownership, documented reasoning, and continuous improvement across protocol health, user trust, adoption, security, liquidity quality, and community participation. For New Zealand, this report combines salary benchmarks in NZD with modeled assumptions for a 33% tax rate, 20 days of annual leave, and a 78.0 cost-of-living index relative to the United States baseline.

High accuracy780 recent job listings and community reports shaped this estimateUpdated 4 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$66,100Annual benchmarkJunior$41,600–$51,4000-2 yearsMid-level$53,200–$79,3003-5 yearsSenior$80,700–$125,5006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 33% tax rate$3,691Hourly equivalentBased on a standard 40-hour week$20.66–$49.26Potential annual bonusIllustrative 10–15% performance range$6,610–$9,915

### Planning reference

Monthly savings target25% illustrative allocation$1,400Retirement contribution17% illustrative allocation$900Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$16,525–$33,050

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 33% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Blockchain Analyst pay in New Zealand.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Blockchain Analyst in New Zealand](https://jobicy.com/api/jpgraph/chart.php?junior_min=41600&junior_max=51400&middle_min=53200&middle_max=79300&senior_min=80700&senior_max=125500&average=66100&currency=%24&currency_code=USD&title=Blockchain%20Analyst&country=New%20Zealand)
Salary ranges

Enlarge
![Salary progression by experience for Blockchain Analyst in New Zealand](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=46500&m_avg=66250&s_avg=103100&currency=%24&currency_code=USD&title=Blockchain%20Analyst&country=New%20Zealand)
Experience growthEnlarge
![Illustrative monthly salary allocation for Blockchain Analyst in New Zealand](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1818&savings=1383&retirement=909&housing=1102&disposable=297&currency=%24&currency_code=USD&title=Blockchain%20Analyst&country=New%20Zealand)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3% over the displayed period, moving from $64,200 to $66,100.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$66,100$21–$49Sep 2026$66,200$21–$49Aug 2026$67,500$21–$50Jul 2026$66,600$21–$50Jun 2026$69,500$22–$52May 2026$67,200$21–$50Apr 2026$69,600$22–$52Mar 2026$66,900$21–$50Feb 2026$66,000$21–$49Jan 2026$67,100$21–$50Dec 2025$65,800$21–$49Nov 2025$64,200$20–$48Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior Blockchain Intelligence Analyst, RansomwareTRM Labs→](https://jobicy.com/jobs/155136-senior-blockchain-intelligence-analyst-ransomware.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior / Staff Intelligence Analyst, Environmental CrimesTRM Labs→](https://jobicy.com/jobs/155032-senior-staff-intelligence-analyst-environmental-crimes.md) [![OKX logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/c6a69151-221-1.png) Compliance Analyst / Senior Compliance Analyst (Special Investigations)OKX→](https://jobicy.com/jobs/155031-compliance-analyst-senior-compliance-analyst-special-investigations.md) [![Dune logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/9fd6085e-221.png) Staff Software Engineer - DataDune→](https://jobicy.com/jobs/152919-staff-software-engineer-data.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior / Staff Threat Intelligence Analyst, HacksTRM Labs→](https://jobicy.com/jobs/154835-senior-staff-threat-intelligence-analyst-hacks.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Blockchain%20Analyst.md)Career profile

## Pay drivers and skills for Blockchain Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Blockchain fundamentalsWallet and transaction analysisToken economicsProtocol researchRisk assessmentCommunity communication

### Education requirements

A degree in computer science, economics, finance, or equivalent blockchain industry experiencePractical understanding of public ledgers, wallet security, protocol incentives, and rapidly changing regulation

### Training and development

Regulatory update briefingsWallet security simulationsProtocol risk reviewsToken design workshopsOn-chain analytics labs

### Core skills

Blockchain fundamentalsWallet and transaction analysisToken economicsProtocol researchRisk assessmentCommunity communicationData interpretationSecurity awareness

### Trending and emerging skills

DAO governanceCross-chain infrastructureLayer 2 ecosystemsOn-chain analyticsAccount abstractionZero-knowledge systemsReal-world asset tokenizationIntent-based transactionsDecentralized identity

### Key responsibilities

Own the planning and delivery of work in the Blockchain Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against protocol health, user trust, adoption, security, liquidity quality, and community participationCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Protocol and smart-contract complexitySecurity and custody responsibilityOn-chain research or engineering depthToken and market-structure knowledgeRegulatory exposureTrack record in production blockchain ecosystems

### Typical career path

Entry-level or associate role in the disciplineBlockchain AnalystSenior Blockchain AnalystProtocol leadership, principal specialist, research leadership, or ecosystem strategy

### Work specifics

Distributed web3 team operating across public communities, fast-moving protocols, and security-sensitive workflowsCoordinates with protocol engineers, researchers, legal advisers, finance teams, partners, and community contributorsUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseEtherscanHardhatFoundryDuneDiscordNotionGitHubWallet testnets

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/nz/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/nz/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/nz/analytics-implementation-manager.md)[Blockchain Developer →](https://jobicy.com/salaries/nz/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/nz/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/nz/blockchain-security-analyst.md)[Business Analyst →](https://jobicy.com/salaries/nz/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/nz/business-intelligence-analyst.md)[Customer Experience Analyst →](https://jobicy.com/salaries/nz/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/nz/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/nz/customer-intelligence-analyst.md)[Data Engineer →](https://jobicy.com/salaries/nz/data-engineer.md)[Data Entry Specialist →](https://jobicy.com/salaries/nz/data-entry-specialist.md)[Data Governance Manager →](https://jobicy.com/salaries/nz/data-governance-manager.md)[Data Governance Specialist →](https://jobicy.com/salaries/nz/data-governance-specialist.md)[Data Migration Specialist →](https://jobicy.com/salaries/nz/data-migration-specialist.md)Market intelligence

## Hiring context for Blockchain Analyst in New Zealand.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Growing adoption of hybrid work models allowing flexibility between office and remote work, with 2-3 days of remote work becoming standard

###

Key industries

BlockchainFinTechDeveloper InfrastructureDigital AssetsCross-country pay scale

## Compare Blockchain Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$76,80016% higher](https://jobicy.com/salaries/ae/blockchain-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$56,50015% lower](https://jobicy.com/salaries/at/blockchain-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$93,50041% higher](https://jobicy.com/salaries/au/blockchain-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$64,0003% lower](https://jobicy.com/salaries/be/blockchain-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$91,30038% higher](https://jobicy.com/salaries/ca/blockchain-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$125,00089% higher](https://jobicy.com/salaries/ch/blockchain-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$80,60022% higher](https://jobicy.com/salaries/de/blockchain-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$45,70031% lower](https://jobicy.com/salaries/es/blockchain-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Blockchain Analyst salary in New Zealand?

The estimated average annual salary is $66,100. Junior roles are estimated at $41,600–$51,400, while senior roles are estimated at $80,700–$125,500.

What is the hourly rate for this role?

The estimated hourly equivalent is between $20.66 and $49.26 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Blockchain fundamentals, Wallet and transaction analysis, Token economics, Protocol research, Risk assessment. Trending and emerging requirements include DAO governance, Cross-chain infrastructure, Layer 2 ecosystems, On-chain analytics, Account abstraction.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Blockchain Analyst in New Zealand, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for New Zealand and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Blockchain Analyst in New Zealand, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Blockchain%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)