[Salaries in New Zealand](https://jobicy.com/salaries/nz.md)2026 Salary Report

# Payment Systems Analyst salary in New Zealand.

The average salary for Payment Systems Analyst in New Zealand is $68,800 per year, according to Jobicy salary data updated 9 Oct 2026. Entry-level positions start around $42,900–$57,800, while experienced professionals earn $82,200–$127,800.
Average compensation has decreased 3.9% over the past 12 months.
Demand is high, with a 20% annual growth rate.

Data: Jobicy salary estimates · Updated 9 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$68,800Estimated annual average$3,841Estimated monthly take-home$21.50–$51.27Hourly equivalent range9 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

A Payment Systems Analyst analyzes payment flows, authorization, settlement, reconciliation, fraud signals, and operational reliability. The work combines subject-matter judgment with disciplined execution and is commonly assessed through forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulness. For New Zealand, this report combines salary benchmarks in NZD with modeled assumptions for a 33% tax rate, 20 days of annual leave, and a 78.0 cost-of-living index relative to the United States baseline.

High accuracy1006 recent job listings and community reports shaped this estimateUpdated 9 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$68,800Annual benchmarkJunior$42,900–$57,8000-2 yearsMid-level$53,700–$83,5003-5 yearsSenior$82,200–$127,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 33% tax rate$3,841Hourly equivalentBased on a standard 40-hour week$21.50–$51.27Potential annual bonusIllustrative 10–15% performance range$6,880–$10,320

### Planning reference

Monthly savings target30% illustrative allocation$1,700Retirement contribution12% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$17,200–$34,400

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 33% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Payment Systems Analyst pay in New Zealand.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Payment Systems Analyst in New Zealand](https://jobicy.com/api/jpgraph/chart.php?junior_min=42900&junior_max=57800&middle_min=53700&middle_max=83500&senior_min=82200&senior_max=127800&average=68800&currency=%24&currency_code=USD&title=Payment%20Systems%20Analyst&country=New%20Zealand)
Salary ranges

Enlarge
![Salary progression by experience for Payment Systems Analyst in New Zealand](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=50350&m_avg=68600&s_avg=105000&currency=%24&currency_code=USD&title=Payment%20Systems%20Analyst&country=New%20Zealand)
Experience growthEnlarge
![Illustrative monthly salary allocation for Payment Systems Analyst in New Zealand](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1892&savings=1697&retirement=665&housing=1147&disposable=333&currency=%24&currency_code=USD&title=Payment%20Systems%20Analyst&country=New%20Zealand)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 3.9% over the displayed period, moving from $71,600 to $68,800.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$68,800$22–$51Sep 2026$71,000$22–$53Aug 2026$71,200$22–$53Jul 2026$69,000$22–$51Jun 2026$70,000$22–$52May 2026$69,200$22–$52Apr 2026$68,700$21–$51Mar 2026$69,400$22–$52Feb 2026$67,400$21–$50Jan 2026$72,000$23–$54Dec 2025$67,700$21–$50Nov 2025$71,600$22–$53Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Feedzai logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5cf089c4-221.png) Software Engineer - Customer SuccessFeedzai→](https://jobicy.com/jobs/146138-software-engineer-customer-success.md) [![ClickUp logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/cd5be0ef-221.jpg) CX Operations AnalystClickUp→](https://jobicy.com/jobs/155181-cx-operations-analyst.md) [![Jobber logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/135a74b7-221.jpeg) Staff Data EngineerJobber→](https://jobicy.com/jobs/154934-staff-data-engineer-2.md) [![Paddle logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/28ca3645-221.png) Staff Product ManagerPaddle→](https://jobicy.com/jobs/154921-staff-product-manager-3.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Payment%20Systems%20Analyst.md)Career profile

## Pay drivers and skills for Payment Systems Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Financial analysisForecastingReconciliationFinancial modelingControlsVariance analysis

### Education requirements

A degree in finance, accounting, economics, mathematics, or equivalent professional experienceStrong spreadsheet, analytical, control, and financial communication skills supported by verifiable work

### Training and development

Data visualization trainingAutomation and systems labsFinancial modeling practiceControl and compliance refreshersScenario-planning workshops

### Professional certifications

CPA, CFA, ACCA, or equivalent when relevant

### Core skills

Financial analysisForecastingReconciliationFinancial modelingControlsVariance analysisReportingBusiness partnering

### Trending and emerging skills

Real-time reportingIntegrated business planningContinuous planningFinance automationScenario modelingAI-assisted forecastingEmbedded financeDigital asset accountingAutomated controls monitoring

### Key responsibilities

Own the planning and delivery of work in the Payment Systems Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against forecast accuracy, control quality, reporting timeliness, risk visibility, cash impact, and decision usefulnessCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Financial complexity and materialityPlanning, control, or reporting ownershipProfessional qualificationsSystems and automation capabilityRegulatory and audit exposureInfluence on capital and operating decisions

### Typical career path

Entry-level or associate role in the disciplinePayment Systems AnalystSenior Payment Systems AnalystSenior analyst, finance manager, controllership, treasury, or finance leadership

### Work specifics

Distributed finance team operating through controlled systems, reviewable models, scheduled reporting, and documented approvalsPartners with accounting, operations, leadership, legal, sales, product, and external advisersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseExcelGoogle SheetsERP systemsPower BISQLPlanning softwareReconciliation tools

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/nz/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/nz/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/nz/analytics-implementation-manager.md)[Blockchain Analyst →](https://jobicy.com/salaries/nz/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/nz/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/nz/business-intelligence-analyst.md)[Customer Experience Analyst →](https://jobicy.com/salaries/nz/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/nz/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/nz/customer-intelligence-analyst.md)[Data Engineer →](https://jobicy.com/salaries/nz/data-engineer.md)[Data Entry Specialist →](https://jobicy.com/salaries/nz/data-entry-specialist.md)[Data Governance Manager →](https://jobicy.com/salaries/nz/data-governance-manager.md)[Data Governance Specialist →](https://jobicy.com/salaries/nz/data-governance-specialist.md)[Data Migration Specialist →](https://jobicy.com/salaries/nz/data-migration-specialist.md)[Data Privacy Consultant →](https://jobicy.com/salaries/nz/data-privacy-consultant.md)[Data Quality Analyst →](https://jobicy.com/salaries/nz/data-quality-analyst.md)Market intelligence

## Hiring context for Payment Systems Analyst in New Zealand.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Expanding global remote workforce supported by investment in virtual team building and online social engagement

###

Key industries

PaymentsFinTechBankingE-commerceCross-country pay scale

## Compare Payment Systems Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$75,1009% higher](https://jobicy.com/salaries/ae/payment-systems-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$57,30017% lower](https://jobicy.com/salaries/at/payment-systems-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$101,00047% higher](https://jobicy.com/salaries/au/payment-systems-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$67,9001% lower](https://jobicy.com/salaries/be/payment-systems-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$93,70036% higher](https://jobicy.com/salaries/ca/payment-systems-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$124,50081% higher](https://jobicy.com/salaries/ch/payment-systems-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$79,20015% higher](https://jobicy.com/salaries/de/payment-systems-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$46,10033% lower](https://jobicy.com/salaries/es/payment-systems-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Payment Systems Analyst salary in New Zealand?

The estimated average annual salary is $68,800. Junior roles are estimated at $42,900–$57,800, while senior roles are estimated at $82,200–$127,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $21.50 and $51.27 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Financial analysis, Forecasting, Reconciliation, Financial modeling, Controls. Trending and emerging requirements include Real-time reporting, Integrated business planning, Continuous planning, Finance automation, Scenario modeling.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Payment Systems Analyst in New Zealand, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for New Zealand and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Payment Systems Analyst in New Zealand, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Payment%20Systems%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)