[Salaries in Portugal](https://jobicy.com/salaries/pt.md)2026 Salary Report

# AI Engineer salary in Portugal.

The average salary for AI Engineer in Portugal is $64,400 per year, according to Jobicy salary data updated 7 Oct 2026. Entry-level positions start around $37,500–$51,800, while experienced professionals earn $75,200–$111,100.
Average compensation has increased 9.2% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 7 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$64,400Estimated annual average$3,381Estimated monthly take-home$20.13–$47.99Hourly equivalent range7 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The AI Engineer role plans and delivers work in the ai engineer discipline using clear goals, evidence, and accountable execution. Professionals in this position turn ambiguous needs into reviewable work, coordinate the people affected by it, and improve results through evidence such as model quality, latency, reliability, safety, adoption, and inference cost. For Portugal, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 55.0 cost-of-living index relative to the United States baseline.

Reliable accuracy238 recent job listings and community reports shaped this estimateUpdated 7 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$64,400Annual benchmarkJunior$37,500–$51,8000-2 yearsMid-level$50,200–$76,9003-5 yearsSenior$75,200–$111,1006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$3,381Hourly equivalentBased on a standard 40-hour week$20.13–$47.99Potential annual bonusIllustrative 10–15% performance range$6,440–$9,660

### Planning reference

Monthly savings target31% illustrative allocation$1,600Retirement contribution11% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$16,100–$32,200

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to AI Engineer pay in Portugal.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for AI Engineer in Portugal](https://jobicy.com/api/jpgraph/chart.php?junior_min=37500&junior_max=51800&middle_min=50200&middle_max=76900&senior_min=75200&senior_max=111100&average=64400&currency=%24&currency_code=USD&title=AI%20Engineer&country=Portugal)
Salary ranges

Enlarge
![Salary progression by experience for AI Engineer in Portugal](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=44650&m_avg=63550&s_avg=93150&currency=%24&currency_code=USD&title=AI%20Engineer&country=Portugal)
Experience growthEnlarge
![Illustrative monthly salary allocation for AI Engineer in Portugal](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1986&savings=1637&retirement=574&housing=1073&disposable=97&currency=%24&currency_code=USD&title=AI%20Engineer&country=Portugal)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 9.2% over the displayed period, moving from $59,000 to $64,400.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$64,400$20–$48Sep 2026$60,700$19–$45Aug 2026$60,900$19–$45Jul 2026$61,500$19–$46Jun 2026$63,100$20–$47May 2026$61,800$19–$46Apr 2026$59,600$19–$44Mar 2026$59,600$19–$44Feb 2026$62,200$19–$46Jan 2026$58,200$18–$43Dec 2025$61,000$19–$45Nov 2025$59,000$18–$44Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Spotify logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210328105941-289246.jpg) Principal Product Manager - PersonalizationSpotify→](https://jobicy.com/jobs/155213-principal-product-manager-personalization.md) [![Quince logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b33b4553-221.png) Senior Manager, Global Procurement (Materials)Quince→](https://jobicy.com/jobs/155212-senior-manager-global-procurement-materials.md) [![Quince logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b33b4553-221.png) Cashmere Lab Testing & Quality LeaderQuince→](https://jobicy.com/jobs/155209-cashmere-lab-testing-quality-leader.md) [![Spotify logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210328105941-289246.jpg) Research Scientist - Generative AudioSpotify→](https://jobicy.com/jobs/155214-research-scientist-generative-audio.md) [![Spotify logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210328105941-289246.jpg) Principal Product Manager - Format FoundationsSpotify→](https://jobicy.com/jobs/155210-principal-product-manager-format-foundations.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=AI%20Engineer.md)Career profile

## Pay drivers and skills for AI Engineer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 4-7 years of directly relevant experience supported by evidence of independent, high-impact delivery

### Required skills

PythonMachine learningModel evaluationData preparationExperiment designSoftware engineering

### Education requirements

A degree in computer science, machine learning, mathematics, or equivalent applied experienceA portfolio showing model evaluation, data handling, and production implementation

### Training and development

Data quality workshopsMLOps deployment labsModel evaluation and red-team exercisesResponsible AI and governance trainingProduction inference optimization

### Core skills

PythonMachine learningModel evaluationData preparationExperiment designSoftware engineeringStatisticsResponsible AI

### Trending and emerging skills

Model observabilityLarge language modelsRetrieval-augmented generationMLOpsVector searchAI agentsMultimodal systemsSynthetic dataSmall language models

### Key responsibilities

Own the planning and delivery of work in the AI Engineer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against model quality, latency, reliability, safety, adoption, and inference costInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Model and data complexityProduction deployment experienceEvaluation, safety, and governance expertiseInference performance and cost ownershipDomain-specific AI knowledgeAbility to connect research with product outcomes

### Typical career path

Entry-level or associate role in the disciplineAI EngineerSenior AI EngineerLead AI specialist, AI operations leadership, research engineering, or AI product leadership

### Work specifics

Cross-functional AI product team combining experimentation with production engineering and documented model governancePartners with data, product, legal, security, and platform teams to move models into reliable useUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responsePythonPyTorchHugging FaceMLflowDockerGitCloud ML platforms

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Training Specialist →](https://jobicy.com/salaries/pt/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/pt/analytics-implementation-manager.md)[API Integration Specialist →](https://jobicy.com/salaries/pt/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/pt/automation-engineer.md)[Blockchain Analyst →](https://jobicy.com/salaries/pt/blockchain-analyst.md)[Blockchain Developer →](https://jobicy.com/salaries/pt/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/pt/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/pt/blockchain-security-analyst.md)[Business Analyst →](https://jobicy.com/salaries/pt/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/pt/business-intelligence-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/pt/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/pt/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/pt/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/pt/cplusplus-developer.md)[Customer Experience Analyst →](https://jobicy.com/salaries/pt/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/pt/customer-insights-manager.md)Market intelligence

## Hiring context for AI Engineer in Portugal.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Strong preference for flexible work arrangements including asynchronous communication and results-based performance evaluation

###

Key industries

Artificial IntelligenceData PlatformsSoftware as a ServiceEdTechCross-country pay scale

## Compare AI Engineer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$106,60066% higher](https://jobicy.com/salaries/ae/ai-engineer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$84,60031% higher](https://jobicy.com/salaries/at/ai-engineer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$140,400118% higher](https://jobicy.com/salaries/au/ai-engineer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$94,90047% higher](https://jobicy.com/salaries/be/ai-engineer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$136,600112% higher](https://jobicy.com/salaries/ca/ai-engineer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$172,700168% higher](https://jobicy.com/salaries/ch/ai-engineer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$114,40078% higher](https://jobicy.com/salaries/de/ai-engineer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$66,0002% higher](https://jobicy.com/salaries/es/ai-engineer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average AI Engineer salary in Portugal?

The estimated average annual salary is $64,400. Junior roles are estimated at $37,500–$51,800, while senior roles are estimated at $75,200–$111,100.

What is the hourly rate for this role?

The estimated hourly equivalent is between $20.13 and $47.99 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Python, Machine learning, Model evaluation, Data preparation, Experiment design. Trending and emerging requirements include Model observability, Large language models, Retrieval-augmented generation, MLOps, Vector search.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for AI Engineer in Portugal, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Portugal and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for AI Engineer in Portugal, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=AI%20Engineer.md)[Salary API](https://jobicy.com/salary-api.md)