[Salaries in Portugal](https://jobicy.com/salaries/pt.md)2026 Salary Report

# Cloud Security Architect salary in Portugal.

A successful Cloud Security Architect designs cloud controls for identity, networks, workloads, data, monitoring, and regulatory requirements. Rather than measuring activity alone, organizations usually evaluate the role through risk reduction, detection coverage, remediation time, control effectiveness, and incident severity. For Portugal, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 55.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$67,000Estimated annual average$3,518Estimated monthly take-home$20.94–$49.93Hourly equivalent range8 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy127 recent job listings and community reports shaped this estimateUpdated 8 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$67,000Annual benchmarkJunior$39,100–$56,3000-2 yearsMid-level$53,100–$79,8003-5 yearsSenior$77,700–$126,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$3,518Hourly equivalentBased on a standard 40-hour week$20.94–$49.93Potential annual bonusIllustrative 10–15% performance range$6,700–$10,050

### Planning reference

Monthly savings target31% illustrative allocation$1,700Retirement contribution13% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,100Emergency fundThree to six months of gross income$16,750–$33,500

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Cloud Security Architect pay in Portugal.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Cloud Security Architect in Portugal](https://jobicy.com/api/jpgraph/chart.php?junior_min=39100&junior_max=56300&middle_min=53100&middle_max=79800&senior_min=77700&senior_max=126400&average=67000&currency=%24&currency_code=USD&title=Cloud%20Security%20Architect&country=Portugal)
Salary ranges

Enlarge
![Salary progression by experience for Cloud Security Architect in Portugal](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=47700&m_avg=66450&s_avg=102050&currency=%24&currency_code=USD&title=Cloud%20Security%20Architect&country=Portugal)
Experience growthEnlarge
![Illustrative monthly salary allocation for Cloud Security Architect in Portugal](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=2066&savings=1703&retirement=715&housing=1117&disposable=0&currency=%24&currency_code=USD&title=Cloud%20Security%20Architect&country=Portugal)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 8.1% over the displayed period, moving from $62,000 to $67,000.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$67,000$21–$50Sep 2026$64,200$20–$48Aug 2026$66,200$21–$49Jul 2026$66,200$21–$49Jun 2026$66,400$21–$49May 2026$64,600$20–$48Apr 2026$65,700$21–$49Mar 2026$64,900$20–$48Feb 2026$64,000$20–$48Jan 2026$65,300$20–$49Dec 2025$62,000$19–$46Nov 2025$62,000$19–$46Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Chainguard logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/e4b6aacf-221.jpeg) Engineering Manager, AI CICDChainguard→](https://jobicy.com/jobs/155140-engineering-manager-ai-cicd.md) [![Dataiku logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/5a9d57bf-221.webp) Infrastructure EngineerDataiku→](https://jobicy.com/jobs/155135-infrastructure-engineer-5.md) [![Webflow logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/b75fa7e9-221.jpg) Senior Software Engineer, Cloud (Backend / Infrastructure)Webflow→](https://jobicy.com/jobs/155112-senior-software-engineer-cloud-backend-infrastructure.md) [![Cresta logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/08/4d686e40b22cf2510b627c59afe5fd95.jpg) Senior Forward Deployed Engineer (AI Agent) - UKCresta→](https://jobicy.com/jobs/155100-senior-forward-deployed-engineer-ai-agent-uk.md) [![Paddle logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/28ca3645-221.png) Software Engineer (Platform - SRE)Paddle→](https://jobicy.com/jobs/155096-software-engineer-platform-sre.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Cloud%20Security%20Architect.md)Career profile

## Pay drivers and skills for Cloud Security Architect.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Cloud architectureInfrastructure as codeCost optimizationCloud governanceThreat modelingSecurity testing

### Education requirements

A degree in cybersecurity, computer science, or equivalent hands-on security experienceDemonstrated knowledge of threat modeling, secure systems, incident handling, and responsible disclosure

### Training and development

Incident response exercisesThreat-modeling workshopsCloud security labsSecure code review practiceResponsible disclosure training

### Professional certifications

Security+

### Core skills

Cloud architectureInfrastructure as codeCost optimizationCloud governanceThreat modelingSecurity testingRisk assessmentIncident responseNetwork security

### Trending and emerging skills

Cloud security posture managementSoftware supply-chain securityDetection engineeringSecurity automationZero trustAI security testingPasskey adoptionConfidential computingPost-quantum readiness

### Key responsibilities

Own the planning and delivery of work in the Cloud Security Architect remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against risk reduction, detection coverage, remediation time, control effectiveness, and incident severityCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

Multi-cloud architecture depthCloud spend and migration scopeRegulated workload responsibilitySecurity clearance or regulated-environment experienceIncident severity and on-call scopeThreat exposure and system criticalityCloud and application security depth

### Typical career path

Entry-level or associate role in the disciplineCloud Security ArchitectSenior Cloud Security ArchitectSecurity lead, principal security specialist, security architecture, or security management

### Work specifics

Security team balancing proactive assurance, monitoring, incident response, and clear risk communicationWorks with engineering, IT, legal, compliance, and leadership to reduce practical security exposureUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseAWSTerraformKubernetesCloud monitoringBurp SuiteSIEMWiresharkNmap

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/pt/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/pt/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/pt/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/pt/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/pt/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/pt/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/pt/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/pt/cloud-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/pt/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/pt/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/pt/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/pt/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/pt/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/pt/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/pt/devops-engineer.md)[Digital Forensics Analyst →](https://jobicy.com/salaries/pt/digital-forensics-analyst.md)Market intelligence

## Hiring context for Cloud Security Architect in Portugal.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Adoption of sophisticated project management tools and productivity tracking systems for remote teams

###

Key industries

Cloud ComputingSoftware as a ServiceDeveloper InfrastructureCybersecurityCross-country pay scale

## Compare Cloud Security Architect pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$113,30069% higher](https://jobicy.com/salaries/ae/cloud-security-architect.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$84,00025% higher](https://jobicy.com/salaries/at/cloud-security-architect.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$141,300111% higher](https://jobicy.com/salaries/au/cloud-security-architect.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$104,70056% higher](https://jobicy.com/salaries/be/cloud-security-architect.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$138,600107% higher](https://jobicy.com/salaries/ca/cloud-security-architect.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$189,000182% higher](https://jobicy.com/salaries/ch/cloud-security-architect.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$119,80079% higher](https://jobicy.com/salaries/de/cloud-security-architect.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$72,2008% higher](https://jobicy.com/salaries/es/cloud-security-architect.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Cloud Security Architect salary in Portugal?

The estimated average annual salary is $67,000. Junior roles are estimated at $39,100–$56,300, while senior roles are estimated at $77,700–$126,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $20.94 and $49.93 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Cloud architecture, Infrastructure as code, Cost optimization, Cloud governance, Threat modeling. Trending and emerging requirements include Cloud security posture management, Software supply-chain security, Detection engineering, Security automation, Zero trust.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Cloud Security Architect in Portugal, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Portugal and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Cloud Security Architect in Portugal, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Cloud%20Security%20Architect.md)[Salary API](https://jobicy.com/salary-api.md)