[Salaries in Portugal](https://jobicy.com/salaries/pt.md)2026 Salary Report

# Knowledge Management Specialist salary in Portugal.

The average salary for Knowledge Management Specialist in Portugal is $32,800 per year, according to Jobicy salary data updated 3 Oct 2026. Entry-level positions start around $20,300–$26,100, while experienced professionals earn $40,900–$62,200.
Average compensation has increased 2.8% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 3 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$32,800Estimated annual average$1,722Estimated monthly take-home$10.25–$24.44Hourly equivalent range3 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The core purpose of a Knowledge Management Specialist is practical: the professional makes organizational knowledge easier to capture, govern, discover, trust, and reuse. Day-to-day priorities vary by company, but performance is generally visible in outcome delivery, operational quality, resource efficiency, risk control, stakeholder confidence, and sustainable improvement. For Portugal, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 55.0 cost-of-living index relative to the United States baseline.

Reliable accuracy95 recent job listings and community reports shaped this estimateUpdated 3 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$32,800Annual benchmarkJunior$20,300–$26,1000-2 yearsMid-level$26,300–$39,1003-5 yearsSenior$40,900–$62,2006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$1,722Hourly equivalentBased on a standard 40-hour week$10.25–$24.44Potential annual bonusIllustrative 10–15% performance range$3,280–$4,920

### Planning reference

Monthly savings target25% illustrative allocation$700Retirement contribution13% illustrative allocation$400Housing budgetIllustrative 20% monthly ceilingUp to $500Emergency fundThree to six months of gross income$8,200–$16,400

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Knowledge Management Specialist pay in Portugal.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Knowledge Management Specialist in Portugal](https://jobicy.com/api/jpgraph/chart.php?junior_min=20300&junior_max=26100&middle_min=26300&middle_max=39100&senior_min=40900&senior_max=62200&average=32800&currency=%24&currency_code=USD&title=Knowledge%20Management%20Specialist&country=Portugal)
Salary ranges

Enlarge
![Salary progression by experience for Knowledge Management Specialist in Portugal](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=23200&m_avg=32700&s_avg=51550&currency=%24&currency_code=USD&title=Knowledge%20Management%20Specialist&country=Portugal)
Experience growthEnlarge
![Illustrative monthly salary allocation for Knowledge Management Specialist in Portugal](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1011&savings=678&retirement=361&housing=547&disposable=137&currency=%24&currency_code=USD&title=Knowledge%20Management%20Specialist&country=Portugal)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2.8% over the displayed period, moving from $31,900 to $32,800.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$32,800$10–$24Sep 2026$34,100$11–$25Aug 2026$32,700$10–$24Jul 2026$34,200$11–$25Jun 2026$34,000$11–$25May 2026$34,200$11–$25Apr 2026$33,000$10–$25Mar 2026$33,900$11–$25Feb 2026$33,100$10–$25Jan 2026$34,000$11–$25Dec 2025$31,900$10–$24Nov 2025$31,900$10–$24Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Cobalt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/7a1fbbfd-221.jpg) Senior GTM Systems & AI SpecialistCobalt→](https://jobicy.com/jobs/155196-senior-gtm-systems-ai-specialist.md) [![StackAdapt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/bf5f2bb689c6f35f6cab5459f3eff869.jpg) Manager, Ad OperationsStackAdapt→](https://jobicy.com/jobs/149104-manager-ad-operations.md) [![Rockbot logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/7c035029-221.jpg) Tier 2 Technical Support SpecialistRockbot→](https://jobicy.com/jobs/155154-tier-2-technical-support-specialist.md) [![CCOF logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/e382aaa0-221.png) Livestock Certification SupervisorCCOF→](https://jobicy.com/jobs/155115-livestock-certification-supervisor.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) Mid-Market Implementation Specialist - AmericasAshby→](https://jobicy.com/jobs/155120-mid-market-implementation-specialist-americas.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Knowledge%20Management%20Specialist.md)Career profile

## Pay drivers and skills for Knowledge Management Specialist.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Strategic planningStakeholder managementPrioritizationRisk managementBudget awarenessProcess improvement

### Education requirements

A degree in business, operations, a relevant functional discipline, or equivalent leadership experienceEvidence of planning complex work, aligning stakeholders, managing risk, and improving measurable outcomes

### Training and development

Risk-review workshopsFinancial acumen trainingChange-leadership coachingScenario-planning exercisesFacilitation and negotiation practice

### Professional certifications

PMP, PRINCE2, or equivalent when relevant

### Core skills

Strategic planningStakeholder managementPrioritizationRisk managementBudget awarenessProcess improvementDecision-makingExecutive communication

### Trending and emerging skills

Operational analyticsChange managementObjectives and key resultsDistributed operationsPortfolio prioritizationAI-enabled operationsDynamic resource planningDecision intelligenceResilient operating models

### Key responsibilities

Own the planning and delivery of work in the Knowledge Management Specialist remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against outcome delivery, operational quality, resource efficiency, risk control, stakeholder confidence, and sustainable improvementCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Team, budget, and portfolio scopeStrategic decision responsibilityOperational complexity and riskCross-functional influenceEvidence of measurable transformationExecutive and external stakeholder exposure

### Typical career path

Entry-level or associate role in the disciplineKnowledge Management SpecialistSenior Knowledge Management SpecialistSenior program ownership, functional management, operations leadership, or consulting

### Work specifics

Distributed business team coordinating priorities through documented decisions, measurable plans, and regular operating reviewsAligns leaders, functional specialists, delivery teams, customers, vendors, and external partnersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseAsanaNotionMiroSpreadsheetsBI dashboardsSlackVideo conferencing

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/pt/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/pt/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/pt/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/pt/animation-director.md)[Business Analyst →](https://jobicy.com/salaries/pt/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/pt/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/pt/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/pt/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/pt/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/pt/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/pt/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/pt/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/pt/creative-director.md)[Customer Acquisition Manager →](https://jobicy.com/salaries/pt/customer-acquisition-manager.md)[Customer Insights Manager →](https://jobicy.com/salaries/pt/customer-insights-manager.md)[Customer Success Director →](https://jobicy.com/salaries/pt/customer-success-director.md)Market intelligence

## Hiring context for Knowledge Management Specialist in Portugal.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Development of remote-specific career progression paths and virtual mentorship programs

###

Key industries

Software as a ServiceProfessional ServicesE-commerceFinancial ServicesHealthcare TechnologyBusiness ServicesCross-country pay scale

## Compare Knowledge Management Specialist pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$62,10089% higher](https://jobicy.com/salaries/ae/knowledge-management-specialist.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$43,80034% higher](https://jobicy.com/salaries/at/knowledge-management-specialist.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$73,800125% higher](https://jobicy.com/salaries/au/knowledge-management-specialist.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$50,60054% higher](https://jobicy.com/salaries/be/knowledge-management-specialist.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$71,500118% higher](https://jobicy.com/salaries/ca/knowledge-management-specialist.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$97,200196% higher](https://jobicy.com/salaries/ch/knowledge-management-specialist.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$62,60091% higher](https://jobicy.com/salaries/de/knowledge-management-specialist.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$37,50014% higher](https://jobicy.com/salaries/es/knowledge-management-specialist.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Knowledge Management Specialist salary in Portugal?

The estimated average annual salary is $32,800. Junior roles are estimated at $20,300–$26,100, while senior roles are estimated at $40,900–$62,200.

What is the hourly rate for this role?

The estimated hourly equivalent is between $10.25 and $24.44 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Strategic planning, Stakeholder management, Prioritization, Risk management, Budget awareness. Trending and emerging requirements include Operational analytics, Change management, Objectives and key results, Distributed operations, Portfolio prioritization.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Knowledge Management Specialist in Portugal, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Portugal and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Knowledge Management Specialist in Portugal, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Knowledge%20Management%20Specialist.md)[Salary API](https://jobicy.com/salary-api.md)