[Salaries in Portugal](https://jobicy.com/salaries/pt.md)2026 Salary Report

# React Native Developer salary in Portugal.

The core purpose of a React Native Developer is practical: the professional builds cross-platform mobile applications while managing native integrations, performance, testing, and releases. Day-to-day priorities vary by company, but performance is generally visible in reliability, delivery lead time, defect rate, maintainability, and user impact. For Portugal, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 55.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$51,500Estimated annual average$2,704Estimated monthly take-home$16.09–$38.38Hourly equivalent range2 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy290 recent job listings and community reports shaped this estimateUpdated 2 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$51,500Annual benchmarkJunior$31,000–$42,7000-2 yearsMid-level$40,700–$61,2003-5 yearsSenior$60,000–$91,9006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$2,704Hourly equivalentBased on a standard 40-hour week$16.09–$38.38Potential annual bonusIllustrative 10–15% performance range$5,150–$7,725

### Planning reference

Monthly savings target34% illustrative allocation$1,500Retirement contribution15% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $900Emergency fundThree to six months of gross income$12,875–$25,750

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to React Native Developer pay in Portugal.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for React Native Developer in Portugal](https://jobicy.com/api/jpgraph/chart.php?junior_min=31000&junior_max=42700&middle_min=40700&middle_max=61200&senior_min=60000&senior_max=91900&average=51500&currency=%24&currency_code=USD&title=React%20Native%20Developer&country=Portugal)
Salary ranges

Enlarge
![Salary progression by experience for React Native Developer in Portugal](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=36850&m_avg=50950&s_avg=75950&currency=%24&currency_code=USD&title=React%20Native%20Developer&country=Portugal)
Experience growthEnlarge
![Illustrative monthly salary allocation for React Native Developer in Portugal](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1588&savings=1468&retirement=631&housing=858&disposable=0&currency=%24&currency_code=USD&title=React%20Native%20Developer&country=Portugal)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 11.2% over the displayed period, moving from $46,300 to $51,500.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$51,500$16–$38Sep 2026$49,000$15–$37Aug 2026$48,700$15–$36Jul 2026$51,000$16–$38Jun 2026$49,700$16–$37May 2026$50,900$16–$38Apr 2026$51,000$16–$38Mar 2026$50,500$16–$38Feb 2026$48,500$15–$36Jan 2026$46,600$15–$35Dec 2025$46,900$15–$35Nov 2025$46,300$14–$35Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Mattermost logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/02/ecb6ff3992a12e3be49b73ca8a11f5c5.webp) Senior Mobile EngineerMattermost→](https://jobicy.com/jobs/154994-senior-mobile-engineer.md) [![Vercel logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/a6aded72-221.png) Software Engineer, BackendVercel→](https://jobicy.com/jobs/152938-software-engineer-backend.md) [![Deepgram logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201212160008-406229.jpg) Software Test EngineerDeepgram→](https://jobicy.com/jobs/154872-software-test-engineer.md) [![Cision logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/e9661342-221.jpeg) Staff Software DeveloperCision→](https://jobicy.com/jobs/145140-staff-software-developer.md) [![Beyond Finance logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/68cd015e123539d873279c7b82f1ca6a.jpg) Senior Application Security EngineerBeyond Finance→](https://jobicy.com/jobs/154682-senior-application-security-engineer-3.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=React%20Native%20Developer.md)Career profile

## Pay drivers and skills for React Native Developer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

React NativeTypeScriptNative modulesMobile release pipelinesSoftware designData structures

### Education requirements

A degree in computer science, software engineering, or equivalent production experienceEvidence of building, testing, and maintaining software beyond tutorial projects

### Training and development

Production architecture reviewsSecure development lifecycle workshopsPerformance profiling practiceIncident response simulationsCloud deployment labs

### Core skills

React NativeTypeScriptNative modulesMobile release pipelinesSoftware designData structuresDebuggingTestingVersion control

### Trending and emerging skills

AI-assisted developmentCloud-native developmentContinuous deliveryObservabilitySecure codingPlatform engineeringSoftware supply-chain securityAgentic development workflowsEdge computing

### Key responsibilities

Own the planning and delivery of work in the React Native Developer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against reliability, delivery lead time, defect rate, maintainability, and user impactCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidenceCommunicate trade-offs and recommendations in language appropriate for specialists and non-specialists

### What can increase compensation

System scale and technical complexityDepth in the primary programming stackCloud, security, and reliability ownershipArchitecture and technical decision scopeProduction incident responsibilityMentoring and cross-team influence

### Typical career path

Entry-level or associate role in the disciplineReact Native DeveloperSenior React Native DeveloperStaff or principal engineering, architecture, or engineering management

### Work specifics

Remote engineering team working through reviewed code, automated tests, and documented technical decisionsWorks with product, design, quality, security, and infrastructure partners throughout deliveryUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGitGitHubDockerCI/CDPostmanSentryJira

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/pt/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/pt/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/pt/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/pt/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/pt/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/pt/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/pt/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/pt/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/pt/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/pt/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/pt/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/pt/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/pt/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/pt/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/pt/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/pt/devops-engineer.md)Market intelligence

## Hiring context for React Native Developer in Portugal.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Increasing remote opportunities with quarterly team meetups and annual company gatherings for maintaining team cohesion

###

Key industries

Software as a ServiceCloud ComputingFinTechE-commerceCybersecurityDeveloper ToolsCross-country pay scale

## Compare React Native Developer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$92,10079% higher](https://jobicy.com/salaries/ae/react-native-developer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$67,20030% higher](https://jobicy.com/salaries/at/react-native-developer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$109,100112% higher](https://jobicy.com/salaries/au/react-native-developer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$74,60045% higher](https://jobicy.com/salaries/be/react-native-developer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$111,800117% higher](https://jobicy.com/salaries/ca/react-native-developer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$147,200186% higher](https://jobicy.com/salaries/ch/react-native-developer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$91,20077% higher](https://jobicy.com/salaries/de/react-native-developer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$53,5004% higher](https://jobicy.com/salaries/es/react-native-developer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average React Native Developer salary in Portugal?

The estimated average annual salary is $51,500. Junior roles are estimated at $31,000–$42,700, while senior roles are estimated at $60,000–$91,900.

What is the hourly rate for this role?

The estimated hourly equivalent is between $16.09 and $38.38 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include React Native, TypeScript, Native modules, Mobile release pipelines, Software design. Trending and emerging requirements include AI-assisted development, Cloud-native development, Continuous delivery, Observability, Secure coding.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for React Native Developer in Portugal, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Portugal and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for React Native Developer in Portugal, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=React%20Native%20Developer.md)[Salary API](https://jobicy.com/salary-api.md)