[Salaries in Portugal](https://jobicy.com/salaries/pt.md)2026 Salary Report

# Service Design Manager salary in Portugal.

The average salary for Service Design Manager in Portugal is $45,400 per year, according to Jobicy salary data updated 4 Oct 2026. Entry-level positions start around $27,600–$37,200, while experienced professionals earn $56,300–$82,800.
Average compensation has increased 10.5% over the past 12 months.
Demand is growing, with a 15% annual growth rate.

Data: Jobicy salary estimates · Updated 4 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$45,400Estimated annual average$2,384Estimated monthly take-home$14.19–$33.83Hourly equivalent range4 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

The Service Design Manager role improves end-to-end services by connecting user journeys, backstage operations, policy, and delivery systems. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarity. For Portugal, this report combines salary benchmarks in EUR with modeled assumptions for a 37% tax rate, 22 days of annual leave, and a 55.0 cost-of-living index relative to the United States baseline.

Reliable accuracy251 recent job listings and community reports shaped this estimateUpdated 4 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$45,400Annual benchmarkJunior$27,600–$37,2000-2 yearsMid-level$36,000–$56,0003-5 yearsSenior$56,300–$82,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 37% tax rate$2,384Hourly equivalentBased on a standard 40-hour week$14.19–$33.83Potential annual bonusIllustrative 10–15% performance range$4,540–$6,810

### Planning reference

Monthly savings target22% illustrative allocation$800Retirement contribution14% illustrative allocation$500Housing budgetIllustrative 20% monthly ceilingUp to $800Emergency fundThree to six months of gross income$11,350–$22,700

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 37% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Service Design Manager pay in Portugal.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Service Design Manager in Portugal](https://jobicy.com/api/jpgraph/chart.php?junior_min=27600&junior_max=37200&middle_min=36000&middle_max=56000&senior_min=56300&senior_max=82800&average=45400&currency=%24&currency_code=USD&title=Service%20Design%20Manager&country=Portugal)
Salary ranges

Enlarge
![Salary progression by experience for Service Design Manager in Portugal](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=32400&m_avg=46000&s_avg=69550&currency=%24&currency_code=USD&title=Service%20Design%20Manager&country=Portugal)
Experience growthEnlarge
![Illustrative monthly salary allocation for Service Design Manager in Portugal](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1400&savings=836&retirement=511&housing=757&disposable=280&currency=%24&currency_code=USD&title=Service%20Design%20Manager&country=Portugal)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 10.5% over the displayed period, moving from $41,100 to $45,400.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$45,400$14–$34Sep 2026$44,200$14–$33Aug 2026$43,700$14–$33Jul 2026$43,400$14–$32Jun 2026$41,800$13–$31May 2026$44,100$14–$33Apr 2026$42,300$13–$32Mar 2026$42,700$13–$32Feb 2026$41,800$13–$31Jan 2026$42,200$13–$31Dec 2025$42,100$13–$31Nov 2025$41,100$13–$31Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Quince logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b33b4553-221.png) Senior Manager, Global Procurement (Materials)Quince→](https://jobicy.com/jobs/155212-senior-manager-global-procurement-materials.md) [![Spotify logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2021/03/Jobicy-210328105941-289246.jpg) Research Scientist - Generative AudioSpotify→](https://jobicy.com/jobs/155214-research-scientist-generative-audio.md) [![Able logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/b70bf263-221.png) Technical Program ManagerAble→](https://jobicy.com/jobs/155193-technical-program-manager-7.md) [![Collibra logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/25583c1c-221.jpg) Senior Manager, Professional ServicesCollibra→](https://jobicy.com/jobs/155179-senior-manager-professional-services.md) [![ClickUp logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/cd5be0ef-221.jpg) Strategic Solutions EngineerClickUp→](https://jobicy.com/jobs/155176-strategic-solutions-engineer-2.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Service%20Design%20Manager.md)Career profile

## Pay drivers and skills for Service Design Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Visual communicationDesign systemsPrototypingUser-centered designAccessibilityCritique

### Education requirements

A degree in design, visual communication, interaction design, or an equivalent professional portfolioA portfolio that explains process, constraints, iteration, and measurable outcomes rather than only final visuals

### Training and development

Facilitated critique sessionsDesign-system contribution workshopsResearch synthesis practiceAdvanced prototyping labsAccessibility and inclusive design reviews

### Core skills

Visual communicationDesign systemsPrototypingUser-centered designAccessibilityCritiqueInformation hierarchyDesign documentation

### Trending and emerging skills

AI-assisted creative workflowsResponsive systemsInclusive designDesign operationsMotion principlesSpatial interfacesGenerative design systemsMultimodal prototypingReal-time 3D experiences

### Key responsibilities

Own the planning and delivery of work in the Service Design Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against usability, accessibility, consistency, engagement, delivery quality, and stakeholder clarityInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipPortfolio quality and demonstrated outcomesProduct or brand complexityResearch and accessibility capabilityDesign-system ownershipAdvanced production-tool expertise

### Typical career path

Senior individual contributor or team leadService Design ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote creative team using shared design systems, documented feedback, and frequent prototype reviewsWorks closely with research, product, engineering, content, marketing, and brand stakeholdersUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseFigmaAdobe Creative CloudMiroNotionPrototyping toolsAsset librariesProject tracking

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[3D Artist →](https://jobicy.com/salaries/pt/3d-artist.md)[Account Based Marketing Manager →](https://jobicy.com/salaries/pt/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/pt/affiliate-program-manager.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/pt/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/pt/animation-director.md)[AR/VR Designer →](https://jobicy.com/salaries/pt/ar-vr-designer.md)[Business Analyst →](https://jobicy.com/salaries/pt/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/pt/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/pt/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/pt/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/pt/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/pt/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/pt/content-designer.md)[Content Quality Manager →](https://jobicy.com/salaries/pt/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/pt/conversion-optimization-manager.md)[Creative Director →](https://jobicy.com/salaries/pt/creative-director.md)Market intelligence

## Hiring context for Service Design Manager in Portugal.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Integration of virtual reality and augmented reality tools for remote collaboration and training

###

Key industries

Software as a ServiceE-commerceMedia and EntertainmentConsumer TechnologyGamingDigital AgenciesCross-country pay scale

## Compare Service Design Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$79,40075% higher](https://jobicy.com/salaries/ae/service-design-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$56,80025% higher](https://jobicy.com/salaries/at/service-design-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$96,500113% higher](https://jobicy.com/salaries/au/service-design-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$66,50046% higher](https://jobicy.com/salaries/be/service-design-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$96,800113% higher](https://jobicy.com/salaries/ca/service-design-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$124,600174% higher](https://jobicy.com/salaries/ch/service-design-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$84,70087% higher](https://jobicy.com/salaries/de/service-design-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$48,6007% higher](https://jobicy.com/salaries/es/service-design-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Service Design Manager salary in Portugal?

The estimated average annual salary is $45,400. Junior roles are estimated at $27,600–$37,200, while senior roles are estimated at $56,300–$82,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $14.19 and $33.83 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Visual communication, Design systems, Prototyping, User-centered design, Accessibility. Trending and emerging requirements include AI-assisted creative workflows, Responsive systems, Inclusive design, Design operations, Motion principles.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Service Design Manager in Portugal, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Portugal and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Service Design Manager in Portugal, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Service%20Design%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)