[Salaries in Sweden](https://jobicy.com/salaries/se.md)2026 Salary Report

# Data Governance Manager salary in Sweden.

The core purpose of a Data Governance Manager is practical: the professional defines ownership, quality, access, lineage, retention, and policy for trustworthy organizational data. Day-to-day priorities vary by company, but performance is generally visible in accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For Sweden, this report combines salary benchmarks in SEK with modeled assumptions for a 32% tax rate, 25 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$72,900Estimated annual average$4,131Estimated monthly take-home$22.78–$54.32Hourly equivalent range6 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

Reliable accuracy465 recent job listings and community reports shaped this estimateUpdated 6 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$72,900Annual benchmarkJunior$45,900–$60,4000-2 yearsMid-level$59,600–$87,0003-5 yearsSenior$89,700–$130,6006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 32% tax rate$4,131Hourly equivalentBased on a standard 40-hour week$22.78–$54.32Potential annual bonusIllustrative 10–15% performance range$7,290–$10,935

### Planning reference

Monthly savings target27% illustrative allocation$1,600Retirement contribution17% illustrative allocation$1,000Housing budgetIllustrative 20% monthly ceilingUp to $1,200Emergency fundThree to six months of gross income$18,225–$36,450

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 32% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Data Governance Manager pay in Sweden.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Data Governance Manager in Sweden](https://jobicy.com/api/jpgraph/chart.php?junior_min=45900&junior_max=60400&middle_min=59600&middle_max=87000&senior_min=89700&senior_max=130600&average=72900&currency=%24&currency_code=USD&title=Data%20Governance%20Manager&country=Sweden)
Salary ranges

Enlarge
![Salary progression by experience for Data Governance Manager in Sweden](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=53150&m_avg=73300&s_avg=110150&currency=%24&currency_code=USD&title=Data%20Governance%20Manager&country=Sweden)
Experience growthEnlarge
![Illustrative monthly salary allocation for Data Governance Manager in Sweden](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1944&savings=1610&retirement=1033&housing=1215&disposable=273&currency=%24&currency_code=USD&title=Data%20Governance%20Manager&country=Sweden)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 6.3% over the displayed period, moving from $68,600 to $72,900.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$72,900$23–$54Sep 2026$75,300$24–$56Aug 2026$70,500$22–$53Jul 2026$72,100$23–$54Jun 2026$74,500$23–$56May 2026$73,100$23–$54Apr 2026$71,800$22–$54Mar 2026$74,000$23–$55Feb 2026$71,100$22–$53Jan 2026$72,100$23–$54Dec 2025$68,900$22–$51Nov 2025$68,600$21–$51Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Nebius logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2026/06/d90c0566-221.webp) Engineering Manager/Network Team LeadNebius→](https://jobicy.com/jobs/155029-engineering-manager-network-team-lead.md) [![Dropbox logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/09/WRILS-200923071227-398427.jpg) Regional Sales Operations Manager - EMEADropbox→](https://jobicy.com/jobs/155022-regional-sales-operations-manager-emea.md) [![Monzo logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/5b4c0ec3-221.jpg) Controls Product Senior ManagerMonzo→](https://jobicy.com/jobs/155008-controls-product-senior-manager.md) [![Luxury Presence logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/05/f2b241fb769140fff2f70e8efaf5c0ff.jpg) Talent Analyst Specialist (Fully Remote)Luxury Presence→](https://jobicy.com/jobs/155000-talent-analyst-specialist-fully-remote.md) [![Fivetran logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/3b8e4532-221-1.jpg) Compensation & Analytics PartnerFivetran→](https://jobicy.com/jobs/154995-compensation-analytics-partner.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Governance%20Manager.md)Career profile

## Pay drivers and skills for Data Governance Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

SQLData analysisStatisticsData qualityData modelingVisualization

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Privacy-aware analytics trainingAdvanced SQL and query optimizationData governance workshopsExperiment design practiceDashboard accessibility reviews

### Core skills

SQLData analysisStatisticsData qualityData modelingVisualizationExperimentationBusiness communication

### Trending and emerging skills

Self-service analyticsModern data stacksAnalytics engineeringData governanceSemantic layersVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Data Governance Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsTeam size and people-management responsibilityBudget and portfolio ownershipData volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metrics

### Typical career path

Senior individual contributor or team leadData Governance ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeTableauPower BIGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/se/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/se/affiliate-program-manager.md)[AI Engineer →](https://jobicy.com/salaries/se/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/se/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/se/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/se/animation-director.md)[Blockchain Analyst →](https://jobicy.com/salaries/se/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/se/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/se/business-development-manager.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/se/business-intelligence-analyst.md)[Change Management Consultant →](https://jobicy.com/salaries/se/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/se/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/se/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/se/community-success-manager.md)[Content Quality Manager →](https://jobicy.com/salaries/se/content-quality-manager.md)[Conversion Optimization Manager →](https://jobicy.com/salaries/se/conversion-optimization-manager.md)Market intelligence

## Hiring context for Data Governance Manager in Sweden.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Focus on digital well-being and work-life balance initiatives specific to remote work environments

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Data Governance Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$87,40020% higher](https://jobicy.com/salaries/ae/data-governance-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$68,7006% lower](https://jobicy.com/salaries/at/data-governance-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$112,80055% higher](https://jobicy.com/salaries/au/data-governance-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$80,10010% higher](https://jobicy.com/salaries/be/data-governance-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$110,90052% higher](https://jobicy.com/salaries/ca/data-governance-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$139,60091% higher](https://jobicy.com/salaries/ch/data-governance-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$90,20024% higher](https://jobicy.com/salaries/de/data-governance-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$51,90029% lower](https://jobicy.com/salaries/es/data-governance-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Data Governance Manager salary in Sweden?

The estimated average annual salary is $72,900. Junior roles are estimated at $45,900–$60,400, while senior roles are estimated at $89,700–$130,600.

What is the hourly rate for this role?

The estimated hourly equivalent is between $22.78 and $54.32 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include SQL, Data analysis, Statistics, Data quality, Data modeling. Trending and emerging requirements include Self-service analytics, Modern data stacks, Analytics engineering, Data governance, Semantic layers.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Data Governance Manager in Sweden, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Sweden and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Data Governance Manager in Sweden, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Governance%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)