[Salaries in Sweden](https://jobicy.com/salaries/se.md)2026 Salary Report

# Digital Campaign Manager salary in Sweden.

The average salary for Digital Campaign Manager in Sweden is $53,600 per year, according to Jobicy salary data updated 2 Oct 2026. Entry-level positions start around $31,700–$42,200, while experienced professionals earn $66,800–$95,800.
Average compensation has increased 8.1% over the past 12 months.
Demand is moderate to high, with a 18% annual growth rate.

Data: Jobicy salary estimates · Updated 2 Oct 2026 · [How we estimate salaries](#methodology)

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$53,600Estimated annual average$3,037Estimated monthly take-home$16.75–$39.94Hourly equivalent range2 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

A successful Digital Campaign Manager coordinates campaign audiences, creative, channels, budgets, tracking, launches, and optimization. Rather than measuring activity alone, organizations usually evaluate the role through qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contribution. For Sweden, this report combines salary benchmarks in SEK with modeled assumptions for a 32% tax rate, 25 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

Reliable accuracy437 recent job listings and community reports shaped this estimateUpdated 2 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$53,600Annual benchmarkJunior$31,700–$42,2000-2 yearsMid-level$42,600–$64,3003-5 yearsSenior$66,800–$95,8006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 32% tax rate$3,037Hourly equivalentBased on a standard 40-hour week$16.75–$39.94Potential annual bonusIllustrative 10–15% performance range$5,360–$8,040

### Planning reference

Monthly savings target30% illustrative allocation$1,300Retirement contribution13% illustrative allocation$600Housing budgetIllustrative 20% monthly ceilingUp to $900Emergency fundThree to six months of gross income$13,400–$26,800

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 32% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Digital Campaign Manager pay in Sweden.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Digital Campaign Manager in Sweden](https://jobicy.com/api/jpgraph/chart.php?junior_min=31700&junior_max=42200&middle_min=42600&middle_max=64300&senior_min=66800&senior_max=95800&average=53600&currency=%24&currency_code=USD&title=Digital%20Campaign%20Manager&country=Sweden)
Salary ranges

Enlarge
![Salary progression by experience for Digital Campaign Manager in Sweden](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=36950&m_avg=53450&s_avg=81300&currency=%24&currency_code=USD&title=Digital%20Campaign%20Manager&country=Sweden)
Experience growthEnlarge
![Illustrative monthly salary allocation for Digital Campaign Manager in Sweden](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1429&savings=1340&retirement=576&housing=893&disposable=228&currency=%24&currency_code=USD&title=Digital%20Campaign%20Manager&country=Sweden)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 8.1% over the displayed period, moving from $49,600 to $53,600.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$53,600$17–$40Sep 2026$54,000$17–$40Aug 2026$52,100$16–$39Jul 2026$51,600$16–$38Jun 2026$54,100$17–$40May 2026$52,000$16–$39Apr 2026$52,800$17–$39Mar 2026$52,500$16–$39Feb 2026$49,900$16–$37Jan 2026$52,700$16–$39Dec 2025$50,500$16–$38Nov 2025$49,600$16–$37Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Acceleration Partners logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/44be3675-221.png) Partner Growth Manager (LATAM)Acceleration Partners→](https://jobicy.com/jobs/155188-partner-growth-manager-latam.md) [![StackAdapt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/bf5f2bb689c6f35f6cab5459f3eff869.jpg) Sales ManagerStackAdapt→](https://jobicy.com/jobs/155173-sales-manager-6.md) [![StackAdapt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/bf5f2bb689c6f35f6cab5459f3eff869.jpg) Inventory Partnerships Manager (Spanish)StackAdapt→](https://jobicy.com/jobs/155168-inventory-partnerships-manager-spanish.md) [![StackAdapt logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/bf5f2bb689c6f35f6cab5459f3eff869.jpg) Programmatic Account Manager, EnterpriseStackAdapt→](https://jobicy.com/jobs/155170-programmatic-account-manager-enterprise.md) [![Ashby logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/63864ee6-221.png) Snr. Marketing Manager, Enterprise ABM EMEAAshby→](https://jobicy.com/jobs/152037-snr-marketing-manager-enterprise-abm-emea.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Digital%20Campaign%20Manager.md)Career profile

## Pay drivers and skills for Digital Campaign Manager.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 5-8 years of relevant experience, including leadership of complex work and cross-functional decisions

### Required skills

Audience researchPositioningCampaign planningCopywritingAnalyticsExperimentation

### Education requirements

A degree in marketing, communications, business, or equivalent evidence of successful campaign workWorking knowledge of audience research, positioning, measurement, experimentation, and responsible data use

### Training and development

Privacy and consent trainingConversion research practiceMessage testing labsMarketing automation exercisesMeasurement-plan workshops

### Professional certifications

Google Analytics certification

### Core skills

Audience researchPositioningCampaign planningCopywritingAnalyticsExperimentationChannel strategyPerformance reporting

### Trending and emerging skills

AI-assisted content operationsLifecycle marketingFirst-party data strategyMarketing automationIncrementality testingGenerative search optimizationPrivacy-preserving attributionSynthetic audience researchConversational discovery

### Key responsibilities

Own the planning and delivery of work in the Digital Campaign Manager remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against qualified demand, conversion, retention, brand lift, acquisition efficiency, and revenue contributionInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

Team size and people-management responsibilityBudget and portfolio ownershipChannel budget and revenue responsibilityDemonstrated acquisition or retention impactAnalytics and experimentation depthMarket and audience complexityBrand or lifecycle ownership

### Typical career path

Senior individual contributor or team leadDigital Campaign ManagerSenior Manager, Director, or Head of FunctionExecutive, consulting, or specialist leadership

### Work specifics

Distributed marketing team working from campaign briefs, shared calendars, experimentation plans, and performance dashboardsPartners with sales, product, design, content, data, customer teams, and external specialistsUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGoogle Analytics 4HubSpotAhrefsSemrushLooker StudioCRM platformsProject tracking

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowancePerformance BonusesConference Attendance SupportCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[Account Based Marketing Manager →](https://jobicy.com/salaries/se/account-based-marketing-manager.md)[Affiliate Program Manager →](https://jobicy.com/salaries/se/affiliate-program-manager.md)[AI Content Editor →](https://jobicy.com/salaries/se/ai-content-editor.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/se/analytics-implementation-manager.md)[Animation Director →](https://jobicy.com/salaries/se/animation-director.md)[Brand Content Strategist →](https://jobicy.com/salaries/se/brand-content-strategist.md)[Brand Strategist →](https://jobicy.com/salaries/se/brand-strategist.md)[Business Analyst →](https://jobicy.com/salaries/se/business-analyst.md)[Business Development Manager →](https://jobicy.com/salaries/se/business-development-manager.md)[Change Management Consultant →](https://jobicy.com/salaries/se/change-management-consultant.md)[Chat Support Lead →](https://jobicy.com/salaries/se/chat-support-lead.md)[Chief Revenue Officer →](https://jobicy.com/salaries/se/chief-revenue-officer.md)[Community Success Manager →](https://jobicy.com/salaries/se/community-success-manager.md)[Content Designer →](https://jobicy.com/salaries/se/content-designer.md)[Content Optimization Lead →](https://jobicy.com/salaries/se/content-optimization-lead.md)[Content Quality Manager →](https://jobicy.com/salaries/se/content-quality-manager.md)Market intelligence

## Hiring context for Digital Campaign Manager in Sweden.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Moderate to High

Current hiring-demand signal for this role across the tracked market.

Growth

### 18% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Moderate

Implementation of advanced cybersecurity measures and data protection protocols for distributed teams

###

Key industries

Software as a ServiceE-commerceMedia and PublishingConsumer ProductsFinTechDigital AgenciesCross-country pay scale

## Compare Digital Campaign Manager pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$63,80019% higher](https://jobicy.com/salaries/ae/digital-campaign-manager.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$46,00014% lower](https://jobicy.com/salaries/at/digital-campaign-manager.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$83,20055% higher](https://jobicy.com/salaries/au/digital-campaign-manager.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$53,8000% higher](https://jobicy.com/salaries/be/digital-campaign-manager.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$79,30048% higher](https://jobicy.com/salaries/ca/digital-campaign-manager.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$105,30096% higher](https://jobicy.com/salaries/ch/digital-campaign-manager.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$67,50026% higher](https://jobicy.com/salaries/de/digital-campaign-manager.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$37,20031% lower](https://jobicy.com/salaries/es/digital-campaign-manager.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Digital Campaign Manager salary in Sweden?

The estimated average annual salary is $53,600. Junior roles are estimated at $31,700–$42,200, while senior roles are estimated at $66,800–$95,800.

What is the hourly rate for this role?

The estimated hourly equivalent is between $16.75 and $39.94 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Audience research, Positioning, Campaign planning, Copywriting, Analytics. Trending and emerging requirements include AI-assisted content operations, Lifecycle marketing, First-party data strategy, Marketing automation, Incrementality testing.

What is the market outlook?

Jobicy currently classifies demand as Moderate to High, with a growth signal of 18% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Digital Campaign Manager in Sweden, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Sweden and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Digital Campaign Manager in Sweden, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Digital%20Campaign%20Manager.md)[Salary API](https://jobicy.com/salary-api.md)