[Salaries in Sweden](https://jobicy.com/salaries/se.md)2026 Salary Report

# Mobile Developer salary in Sweden.

In a remote organization, a Mobile Developer builds reliable mobile applications around platform conventions, offline behavior, performance, privacy, and release quality. The position rewards independent ownership, documented reasoning, and continuous improvement across reliability, delivery lead time, defect rate, maintainability, and user impact. For Sweden, this report combines salary benchmarks in SEK with modeled assumptions for a 32% tax rate, 25 days of annual leave, and a 75.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$71,000Estimated annual average$4,023Estimated monthly take-home$22.19–$52.91Hourly equivalent range30 Sep 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy665 recent job listings and community reports shaped this estimateUpdated 30 Sep 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$71,000Annual benchmarkJunior$41,500–$57,4000-2 yearsMid-level$57,600–$86,8003-5 yearsSenior$86,200–$131,4006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 32% tax rate$4,023Hourly equivalentBased on a standard 40-hour week$22.19–$52.91Potential annual bonusIllustrative 10–15% performance range$7,100–$10,650

### Planning reference

Monthly savings target29% illustrative allocation$1,700Retirement contribution16% illustrative allocation$1,000Housing budgetIllustrative 20% monthly ceilingUp to $1,200Emergency fundThree to six months of gross income$17,750–$35,500

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 32% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Mobile Developer pay in Sweden.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Mobile Developer in Sweden](https://jobicy.com/api/jpgraph/chart.php?junior_min=41500&junior_max=57400&middle_min=57600&middle_max=86800&senior_min=86200&senior_max=131400&average=71000&currency=%24&currency_code=USD&title=Mobile%20Developer&country=Sweden)
Salary ranges

Enlarge
![Salary progression by experience for Mobile Developer in Sweden](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=49450&m_avg=72200&s_avg=108800&currency=%24&currency_code=USD&title=Mobile%20Developer&country=Sweden)
Experience growthEnlarge
![Illustrative monthly salary allocation for Mobile Developer in Sweden](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1893&savings=1704&retirement=964&housing=1183&disposable=172&currency=%24&currency_code=USD&title=Mobile%20Developer&country=Sweden)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 1% over the displayed period, moving from $70,300 to $71,000.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$71,000$22–$53Sep 2026$74,900$23–$56Aug 2026$73,900$23–$55Jul 2026$73,600$23–$55Jun 2026$73,300$23–$55May 2026$70,400$22–$52Apr 2026$72,900$23–$54Mar 2026$69,400$22–$52Feb 2026$72,800$23–$54Jan 2026$74,100$23–$55Dec 2025$71,400$22–$53Nov 2025$70,300$22–$52Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Deepgram logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/12/WRILS-201212160008-406229.jpg) Software Test EngineerDeepgram→](https://jobicy.com/jobs/154872-software-test-engineer.md) [![Vercel logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/a6aded72-221.png) Security Software Engineer, IAMVercel→](https://jobicy.com/jobs/147750-security-software-engineer-iam.md) [![Upside logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/06e64944-221.png) Staff Application Security EngineerUpside→](https://jobicy.com/jobs/152657-staff-application-security-engineer.md) [![Webbing logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/08/0a1bcd0e-221.png) Workflow Developer & TesterWebbing→](https://jobicy.com/jobs/143728-workflow-developer-tester.md) [![Beyond Finance logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/01/68cd015e123539d873279c7b82f1ca6a.jpg) Senior Application Security EngineerBeyond Finance→](https://jobicy.com/jobs/154682-senior-application-security-engineer-3.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Mobile%20Developer.md)Career profile

## Pay drivers and skills for Mobile Developer.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

Software designData structuresDebuggingTestingVersion controlAPI design

### Education requirements

A degree in computer science, software engineering, or equivalent production experienceEvidence of building, testing, and maintaining software beyond tutorial projects

### Training and development

Incident response simulationsCloud deployment labsProduction architecture reviewsSecure development lifecycle workshopsPerformance profiling practice

### Core skills

Software designData structuresDebuggingTestingVersion controlAPI designCode reviewTechnical documentation

### Trending and emerging skills

Secure codingAI-assisted developmentCloud-native developmentContinuous deliveryObservabilityPlatform engineeringSoftware supply-chain securityAgentic development workflowsEdge computing

### Key responsibilities

Own the planning and delivery of work in the Mobile Developer remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against reliability, delivery lead time, defect rate, maintainability, and user impactInvestigate problems using relevant qualitative and quantitative evidence before recommending actionCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reused

### What can increase compensation

System scale and technical complexityDepth in the primary programming stackCloud, security, and reliability ownershipArchitecture and technical decision scopeProduction incident responsibilityMentoring and cross-team influence

### Typical career path

Entry-level or associate role in the disciplineMobile DeveloperSenior Mobile DeveloperStaff or principal engineering, architecture, or engineering management

### Work specifics

Remote engineering team working through reviewed code, automated tests, and documented technical decisionsWorks with product, design, quality, security, and infrastructure partners throughout deliveryUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseGitGitHubDockerCI/CDPostmanSentryJira

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendCompulsory Health Insurance IntegrationMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/se/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/se/ai-training-specialist.md)[API Integration Specialist →](https://jobicy.com/salaries/se/api-integration-specialist.md)[Automation Engineer →](https://jobicy.com/salaries/se/automation-engineer.md)[Blockchain Developer →](https://jobicy.com/salaries/se/blockchain-developer.md)[Blockchain Protocol Developer →](https://jobicy.com/salaries/se/blockchain-protocol-developer.md)[Blockchain Security Analyst →](https://jobicy.com/salaries/se/blockchain-security-analyst.md)[Cloud Architect →](https://jobicy.com/salaries/se/cloud-architect.md)[Cloud Security Architect →](https://jobicy.com/salaries/se/cloud-security-architect.md)[Cloud Solutions Architect →](https://jobicy.com/salaries/se/cloud-solutions-architect.md)[C++ Developer →](https://jobicy.com/salaries/se/cplusplus-developer.md)[Cybersecurity Analyst →](https://jobicy.com/salaries/se/cybersecurity-analyst.md)[Data Engineer →](https://jobicy.com/salaries/se/data-engineer.md)[Data Migration Specialist →](https://jobicy.com/salaries/se/data-migration-specialist.md)[Database Administrator →](https://jobicy.com/salaries/se/database-administrator.md)[DevOps Engineer →](https://jobicy.com/salaries/se/devops-engineer.md)Market intelligence

## Hiring context for Mobile Developer in Sweden.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### Growing

Current hiring-demand signal for this role across the tracked market.

Growth

### 15% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### Growing

Focus on building strong remote company culture through regular virtual team activities and online community building

###

Key industries

Software as a ServiceCloud ComputingFinTechE-commerceCybersecurityDeveloper ToolsCross-country pay scale

## Compare Mobile Developer pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$86,40022% higher](https://jobicy.com/salaries/ae/mobile-developer.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$64,5009% lower](https://jobicy.com/salaries/at/mobile-developer.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$109,50054% higher](https://jobicy.com/salaries/au/mobile-developer.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$77,0008% higher](https://jobicy.com/salaries/be/mobile-developer.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$106,00049% higher](https://jobicy.com/salaries/ca/mobile-developer.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$144,000103% higher](https://jobicy.com/salaries/ch/mobile-developer.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$92,10030% higher](https://jobicy.com/salaries/de/mobile-developer.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$55,10022% lower](https://jobicy.com/salaries/es/mobile-developer.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Mobile Developer salary in Sweden?

The estimated average annual salary is $71,000. Junior roles are estimated at $41,500–$57,400, while senior roles are estimated at $86,200–$131,400.

What is the hourly rate for this role?

The estimated hourly equivalent is between $22.19 and $52.91 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include Software design, Data structures, Debugging, Testing, Version control. Trending and emerging requirements include Secure coding, AI-assisted development, Cloud-native development, Continuous delivery, Observability.

What is the market outlook?

Jobicy currently classifies demand as Growing, with a growth signal of 15% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Mobile Developer in Sweden, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for Sweden and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Mobile Developer in Sweden, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Mobile%20Developer.md)[Salary API](https://jobicy.com/salary-api.md)