[Salaries in United Kingdom](https://jobicy.com/salaries/uk.md)2026 Salary Report

# Data Quality Analyst salary in United Kingdom.

The Data Quality Analyst role finds, measures, and prevents data defects through profiling, validation rules, ownership, and remediation. Strong performance requires clear decisions, reliable follow-through, and an ability to explain trade-offs; useful outcome measures include accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insight. For United Kingdom, this report combines salary benchmarks in GBP with modeled assumptions for a 20% tax rate, 28 days of annual leave, and a 78.0 cost-of-living index relative to the United States baseline.

[View salary breakdown](#salary-overview)[Submit salary data](https://forms.gle/hQXsFmx7FZbgyejg7)Share

Link copied$69,400Estimated annual average$4,627Estimated monthly take-home$21.69–$51.72Hourly equivalent range5 Oct 2026Last benchmark update  Explore this salary report Compensation overview

## One role, four useful reference points.

Salary ranges reflect different experience levels. Actual offers can vary with company size, industry, location, contract type, specialized skills, benefits, equity, and negotiation.

High accuracy1407 recent job listings and community reports shaped this estimateUpdated 5 Oct 2026CurrencyUSDAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPFOKGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKIDKMFKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTNSYPSZLTHBTJSTMTTNDTOPTRYTTDTVDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXDRXOFXPFYERZARZMWZWGZWLAverage salary$69,400Annual benchmarkJunior$42,900–$55,1000-2 yearsMid-level$56,900–$83,3003-5 yearsSenior$85,400–$125,3006+ years

### Earnings breakdown

Monthly take-homeEstimated after an average 20% tax rate$4,627Hourly equivalentBased on a standard 40-hour week$21.69–$51.72Potential annual bonusIllustrative 10–15% performance range$6,940–$10,410

### Planning reference

Monthly savings target34% illustrative allocation$2,000Retirement contribution12% illustrative allocation$700Housing budgetIllustrative 20% monthly ceilingUp to $1,200Emergency fundThree to six months of gross income$17,350–$34,700

### Healthcare infrastructure

State-supported healthcare contextCore healthcare access is generally supported through public systems and localized tax contributions. Coverage and supplemental costs vary.Included in ≈ 20% tax model
*
![Upload CV](data:image/svg+xml;base64,PHN2ZyB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHdpZHRoPSI2NSIgaGVpZ2h0PSI2NSIgZmlsbD0ibm9uZSIgeG1sbnM6dj0iaHR0cHM6Ly92ZWN0YS5pby9uYW5vIj48ZyBjbGlwLXBhdGg9InVybCgjQSkiPjxwYXRoIGQ9Ik0wIDBINjVWNjVIMFYwWiIgZmlsbD0iIzAyOWFlYiIvPjxnIGZpbGw9IiNmZmYiIHN0cm9rZT0iI2ZmZiIgc3Ryb2tlLXdpZHRoPSIyIj48cGF0aCBkPSJNMzMuMDQ5IDE1LjQ1NGExLjQzIDEuNDMgMCAwIDAtMi4wOTcgMGwtNy41NzkgOC4xNDdhMS4zOCAxLjM4IDAgMCAwIC4wOSAxLjk3MyAxLjQ0IDEuNDQgMCAwIDAgMi4wMDgtLjA4OGw1LjEwOS01LjQ5MnYyMC42MWExLjQxIDEuNDEgMCAwIDAgMS40MjEgMS4zOTdjLjc4NSAwIDEuNDIxLS42MjUgMS40MjEtMS4zOTd2LTIwLjYxbDUuMTA5IDUuNDkyYTEuNDQgMS40NCAwIDAgMCAyLjAwOC4wODggMS4zOCAxLjM4IDAgMCAwIC4wOS0xLjk3M2wtNy41NzktOC4xNDZ6TTE2Ljc2OSAzOC40YzAtLjc3My0uNjItMS40LTEuMzg1LTEuNFMxNCAzNy42MjcgMTQgMzguNHYuMTAybC4yMTUgNi4yMjljLjIyMyAxLjY4LjcwMSAzLjA5NSAxLjgxMyA0LjIxOHMyLjUxIDEuNjA3IDQuMTcyIDEuODMzYzEuNi4yMTggMy42MzYuMjE4IDYuMTYuMjE4aDExLjI4bDYuMTYtLjIxOGMxLjY2Mi0uMjI2IDMuMDYxLS43MDkgNC4xNzItMS44MzNzMS41ODktMi41MzggMS44MTMtNC4yMThDNTAgNDMuMTEzIDUwIDQxLjA1NSA1MCAzOC41MDNWMzguNGMwLS43NzMtLjYyLTEuNC0xLjM4NS0xLjRzLTEuMzg1LjYyNy0xLjM4NSAxLjRsLS4xOSA1Ljk1OGMtLjE4MiAxLjM3LS41MTUgMi4wOTUtMS4wMjYgMi42MTJzLTEuMjI4Ljg1My0yLjU4MyAxLjAzOGMtMS4zOTUuMTktMy4yNDMuMTkzLTUuODkzLjE5M0gyNi40NjJjLTIuNjUgMC00LjQ5OC0uMDAzLTUuODkzLS4xOTMtMS4zNTUtLjE4NC0yLjA3Mi0uNTIxLTIuNTgzLTEuMDM4cy0uODQ0LTEuMjQyLTEuMDI2LTIuNjEyYy0uMTg3LTEuNDEtLjE5MS0zLjI3OS0uMTkxLTUuOTU4eiIvPjwvZz48L2c+PGRlZnM+PGNsaXBQYXRoIGlkPSJBIj48cGF0aCBmaWxsPSIjZmZmIiBkPSJNMCAwaDY1djY1SDB6Ii8+PC9jbGlwUGF0aD48L2RlZnM+PC9zdmc+)

### Upload your resume now

To unlock remote work opportunities and be discovered by global employers.

Salary visualization

## Visual guide to Data Quality Analyst pay in United Kingdom.

Downloadable charts show experience ranges, salary progression, and an illustrative monthly allocation. Select any chart to view it at full size.

![Salary ranges by experience for Data Quality Analyst in United Kingdom](https://jobicy.com/api/jpgraph/chart.php?junior_min=42900&junior_max=55100&middle_min=56900&middle_max=83300&senior_min=85400&senior_max=125300&average=69400&currency=%24&currency_code=USD&title=Data%20Quality%20Analyst&country=United%20Kingdom)
Salary ranges

Enlarge
![Salary progression by experience for Data Quality Analyst in United Kingdom](https://jobicy.com/api/jpgraph/experience_chart.php?j_avg=49000&m_avg=70100&s_avg=105350&currency=%24&currency_code=USD&title=Data%20Quality%20Analyst&country=United%20Kingdom)
Experience growthEnlarge
![Illustrative monthly salary allocation for Data Quality Analyst in United Kingdom](https://jobicy.com/api/jpgraph/pie_chart.php?taxes=1157&savings=1966&retirement=717&housing=1157&disposable=787&currency=%24&currency_code=USD&title=Data%20Quality%20Analyst&country=United%20Kingdom)
Monthly allocationEnlarge12-month trend

## How the estimate has moved.

The estimated average changed by 2.2% over the displayed period, moving from $67,900 to $69,400.

Monthly salary estimates are available in the following table.PeriodAnnualHourlyOct 2026$69,400$22–$52Sep 2026$69,500$22–$52Aug 2026$69,300$22–$52Jul 2026$69,600$22–$52Jun 2026$67,700$21–$50May 2026$69,900$22–$52Apr 2026$68,700$21–$51Mar 2026$71,200$22–$53Feb 2026$68,000$21–$51Jan 2026$66,700$21–$50Dec 2025$67,400$21–$50Nov 2025$67,900$21–$51Current opportunities

## Move from research to the live market.

These current remote openings provide additional context for titles, employers, and the way this role appears in active hiring.

[![Reddit logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2020/10/Reddit.jpg) International Payroll AnalystReddit→](https://jobicy.com/jobs/155054-international-payroll-analyst.md) [![TRM Labs logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/34aa038c-221.png) Senior / Staff Intelligence Analyst, Environmental CrimesTRM Labs→](https://jobicy.com/jobs/155032-senior-staff-intelligence-analyst-environmental-crimes.md) [![Luxury Presence logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2022/05/f2b241fb769140fff2f70e8efaf5c0ff.jpg) Talent Analyst Specialist (Fully Remote)Luxury Presence→](https://jobicy.com/jobs/155000-talent-analyst-specialist-fully-remote.md) [![Fivetran logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/3b8e4532-221-1.jpg) Compensation & Analytics PartnerFivetran→](https://jobicy.com/jobs/154995-compensation-analytics-partner.md) [![Fivetran logo](https://jobicy.com/data/server-nyc0409/galaxy/mercury/2025/06/3b8e4532-221-1.jpg) Analyst, GTM AnalyticsFivetran→](https://jobicy.com/jobs/154990-analyst-gtm-analytics.md)[View all matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Quality%20Analyst.md)Career profile

## Pay drivers and skills for Data Quality Analyst.

Education is only one signal. Skills, tools, collaboration habits, work environment, and continued learning often have equal influence on compensation and progression.

###

Experience and baseline requirements

Typically 2-5 years of relevant experience, with demonstrated ownership of real projects and measurable outcomes

### Required skills

SQLData analysisStatisticsData qualityData modelingVisualization

### Education requirements

A degree in statistics, mathematics, computer science, economics, or equivalent analytical experiencePractical evidence of turning incomplete data into reproducible analysis or dependable data products

### Training and development

Dashboard accessibility reviewsPrivacy-aware analytics trainingAdvanced SQL and query optimizationData governance workshopsExperiment design practice

### Core skills

SQLData analysisStatisticsData qualityData modelingVisualizationExperimentationBusiness communication

### Trending and emerging skills

Modern data stacksAnalytics engineeringData governanceSemantic layersSelf-service analyticsVector databasesReal-time analyticsData contractsAI-assisted analysis

### Key responsibilities

Own the planning and delivery of work in the Data Quality Analyst remit, from initial problem definition through measurable follow-upApply domain expertise to role-specific decisions while balancing quality, speed, risk, and stakeholder expectationsDefine practical success measures and review progress against accuracy, data freshness, decision usefulness, adoption, reproducibility, and time to insightCoordinate dependencies and decisions with adjacent teams, escalating material risks early and clearlyCreate concise documentation so methods, assumptions, decisions, and handoffs can be reviewed and reusedImprove tools, standards, templates, and workflows based on recurring issues and delivery evidence

### What can increase compensation

Scale and sensitivity of governed datasetsBusiness criticality of owned metricsData volume, quality, and modeling complexityAdvanced SQL and analytical depthOwnership of trusted business metricsExperimentation and statistical expertiseModern data-platform experience

### Typical career path

Entry-level or associate role in the disciplineData Quality AnalystSenior Data Quality AnalystLead analyst, analytics management, data science, or data-platform leadership

### Work specifics

Remote data team with shared metric definitions, versioned analysis, peer review, and governed accessTranslates questions from product, finance, operations, and leadership into measurable analytical workUsually asynchronous, with scheduled overlap for planning, reviews, customer needs, or incident responseSQLPythondbtSnowflakeTableauPower BIGit

### Common and additional benefits

Remote Work OptionsFlexible HoursHome Office AllowanceHigh-end Hardware BudgetLearning & Development StipendMental Health SupportCoworking Space AccessInternet Allowance

### Similar positions

[AI Engineer →](https://jobicy.com/salaries/uk/ai-engineer.md)[AI Training Specialist →](https://jobicy.com/salaries/uk/ai-training-specialist.md)[Analytics Implementation Manager →](https://jobicy.com/salaries/uk/analytics-implementation-manager.md)[Blockchain Analyst →](https://jobicy.com/salaries/uk/blockchain-analyst.md)[Business Analyst →](https://jobicy.com/salaries/uk/business-analyst.md)[Business Intelligence Analyst →](https://jobicy.com/salaries/uk/business-intelligence-analyst.md)[Customer Experience Analyst →](https://jobicy.com/salaries/uk/customer-experience-analyst.md)[Customer Insights Manager →](https://jobicy.com/salaries/uk/customer-insights-manager.md)[Customer Intelligence Analyst →](https://jobicy.com/salaries/uk/customer-intelligence-analyst.md)[Data Engineer →](https://jobicy.com/salaries/uk/data-engineer.md)[Data Entry Specialist →](https://jobicy.com/salaries/uk/data-entry-specialist.md)[Data Governance Manager →](https://jobicy.com/salaries/uk/data-governance-manager.md)[Data Governance Specialist →](https://jobicy.com/salaries/uk/data-governance-specialist.md)[Data Migration Specialist →](https://jobicy.com/salaries/uk/data-migration-specialist.md)[Data Privacy Consultant →](https://jobicy.com/salaries/uk/data-privacy-consultant.md)[Data Scientist →](https://jobicy.com/salaries/uk/data-scientist.md)Market intelligence

## Hiring context for Data Quality Analyst in United Kingdom.

Compensation is influenced by hiring pressure, growth, remote availability, industry demand, and the scarcity of relevant skills.

Demand

### High

Current hiring-demand signal for this role across the tracked market.

Growth

### 20% annual growth

Estimated direction of role demand and compensation opportunity.

Remote work

### High

Implementation of advanced cybersecurity measures and data protection protocols for distributed teams

###

Key industries

Data AnalyticsSoftware as a ServiceFinancial ServicesHealthcare TechnologyE-commerceBusiness IntelligenceCross-country pay scale

## Compare Data Quality Analyst pay across markets.

These comparisons apply Jobicy’s country multipliers to the same role model. Differences reflect market context rather than currency conversion alone.

[![UAE flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ae.svg) UAE$59,70014% lower](https://jobicy.com/salaries/ae/data-quality-analyst.md)[![Austria flag](https://cloud.jobicy.com/nyc4-cold/img/flags/at.svg) Austria$43,90037% lower](https://jobicy.com/salaries/at/data-quality-analyst.md)[![Australia flag](https://cloud.jobicy.com/nyc4-cold/img/flags/au.svg) Australia$74,1007% higher](https://jobicy.com/salaries/au/data-quality-analyst.md)[![Belgium flag](https://cloud.jobicy.com/nyc4-cold/img/flags/be.svg) Belgium$51,70026% lower](https://jobicy.com/salaries/be/data-quality-analyst.md)[![Canada flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ca.svg) Canada$71,3003% higher](https://jobicy.com/salaries/ca/data-quality-analyst.md)[![Switzerland flag](https://cloud.jobicy.com/nyc4-cold/img/flags/ch.svg) Switzerland$97,80041% higher](https://jobicy.com/salaries/ch/data-quality-analyst.md)[![Germany flag](https://cloud.jobicy.com/nyc4-cold/img/flags/de.svg) Germany$61,50011% lower](https://jobicy.com/salaries/de/data-quality-analyst.md)[![Spain flag](https://cloud.jobicy.com/nyc4-cold/img/flags/es.svg) Spain$37,20046% lower](https://jobicy.com/salaries/es/data-quality-analyst.md)Questions answered

## Frequently asked questions.

Quick answers about salary, hourly rates, skills, market outlook, and benefits for this role.

What is the average Data Quality Analyst salary in United Kingdom?

The estimated average annual salary is $69,400. Junior roles are estimated at $42,900–$55,100, while senior roles are estimated at $85,400–$125,300.

What is the hourly rate for this role?

The estimated hourly equivalent is between $21.69 and $51.72 based on a standard full-time schedule. Contract rates may differ.

Which skills are most relevant?

Core skills include SQL, Data analysis, Statistics, Data quality, Data modeling. Trending and emerging requirements include Modern data stacks, Analytics engineering, Data governance, Semantic layers, Self-service analytics.

What is the market outlook?

Jobicy currently classifies demand as High, with a growth signal of 20% annual growth. Availability differs by industry, country, and employer.

Are these salary estimates guaranteed?

No. The figures are informational benchmarks based on market evidence and economic adjustments. Actual compensation depends on experience, skills, location, employer, contract type, benefits, and negotiation.

Methodology

## How this estimate is prepared.

Each Jobicy salary benchmark is produced from our own analysis of compensation signals for this role and market. The estimate is designed as a practical reference, not a guaranteed offer.

01

### Jobicy market sample

We analyze up to 1,000 recent and relevant job listings for Data Quality Analyst in United Kingdom, using disclosed pay ranges and other compensation signals available in the listings.

02

### Local market calibration

Observed compensation signals are normalized for United Kingdom and reviewed across experience levels, currency, work arrangements, and local market conditions.

03

### Anonymous community signals

Anonymous salary information and estimate feedback submitted by Jobicy users through our salary form are used as additional signals when reviewing and refreshing the benchmark.

###

Jobicy data and disclaimer

This benchmark is a Jobicy estimate based on our analysis of recent job-market compensation signals for Data Quality Analyst in United Kingdom, including a sample of up to 1,000 relevant job listings and anonymous salary signals submitted by users. It is not copied from BLS, Eurostat, ILOSTAT, OECD, the World Bank, or another third-party salary database. Actual compensation can vary by experience, employer, location, contract type, benefits, equity, and negotiation. Salary and financial calculations are informational only and do not constitute financial, legal, or tax advice. [Read the full methodology →](https://jobicy.com/tools/help-center/general-questions/how-we-calculate-salary-estimates.md)

### Was this salary estimate helpful?

Your anonymous feedback helps improve future estimates.

Yes[Not quite](https://forms.gle/hQXsFmx7FZbgyejg7)Thank you for helping us improve the salary data.

## Ready to put the benchmark to work?

Explore live remote roles, strengthen your candidate profile, or use Jobicy Salary API to bring global compensation estimates into your own product.

[Find matching jobs](https://jobicy.com/jobs?search_keywords=Data%20Quality%20Analyst.md)[Salary API](https://jobicy.com/salary-api.md)